• Gene id: 7706

Gene Summary

• Gene Symbol: TRIM25   Gene   UCSC   Ensembl
• Aliases: EFP, RNF147, Z147, ZNF147
• Gene name: tripartite motif containing 25
• Alternate names: E3 ubiquitin/ISG15 ligase TRIM25, RING finger protein 147, RING-type E3 ubiquitin transferase, RING-type E3 ubiquitin transferase TRIM25, estrogen-responsive finger protein, tripartite motif protein TRIM25, tripartite motif-containing protein 25, ubiquitin/ISG15,
• Gene location: 17q22 (56914048: 56887908)     Exons: 9     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the cytoplasm. The presen
• OMIM: 600453

Protein Summary

• Protein general information: Q14258  
  • Name: E3 ubiquitin/ISG15 ligase TRIM25 (EC 6.3.2.n3) (Estrogen responsive finger protein) (RING finger protein 147) (RING type E3 ubiquitin transferase) (EC 2.3.2.27) (RING type E3 ubiquitin transferase TRIM25) (Tripartite motif containing protein 25) (Ubiquiti
  • Length: 630  
  • Mass: 70973
  • Tissue specificity: Expressed in breast tumors (at protein level). Ubiquitous. {ECO
• Sequence:

  MAELCPLAEELSCSICLEPFKEPVTTPCGHNFCGSCLNETWAVQGSPYLCPQCRAVYQARPQLHKNTVLCNVVEQ
  FLQADLAREPPADVWTPPARASAPSPNAQVACDHCLKEAAVKTCLVCMASFCQEHLQPHFDSPAFQDHPLQPPVR
  DLLRRKCSQHNRLREFFCPEHSECICHICLVEHKTCSPASLSQASADLEATLRHKLTVMYSQINGASRALDDVRN
  RQQDVRMTANRKVEQLQQEYTEMKALLDASETTSTRKIKEEEKRVNSKFDTIYQILLKKKSEIQTLKEEIEQSLT
  KRDEFEFLEKASKLRGISTKPVYIPEVELNHKLIKGIHQSTIDLKNELKQCIGRLQEPTPSSGDPGEHDPASTHK
  STRPVKKVSKEEKKSKKPPPVPALPSKLPTFGAPEQLVDLKQAGLEAAAKATSSHPNSTSLKAKVLETFLAKSRP
  ELLEYYIKVILDYNTAHNKVALSECYTVASVAEMPQNYRPHPQRFTYCSQVLGLHCYKKGIHYWEVELQKNNFCG
  VGICYGSMNRQGPESRLGRNSASWCVEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVADKVHLM
  YKFRVDFTEALYPAFWVFSAGATLSICSPK

• Structural information:
  • Protein Domains: (439..63-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00548"-)
  • Interpro: IPR001870  IPR003879  IPR013320  IPR006574  IPR003877   IPR042753  IPR001841  IPR013083  IPR017907  
  • Prosite: PS50188 PS00518 PS50089
  • CDD: cd13736
  • PDB: 4CFG 4LTB 5EYA 5FER 5NT1 5NT2 6FLM 6FLN
  • PDBsum: 4CFG 4LTB 5EYA 5FER 5NT1 5NT2 6FLM 6FLN
  • STRING: ENSP00000323889
• Other Databases: GeneCards:  TRIM25  Malacards:  TRIM25

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006513	protein monoubiquitination	IMP	biological process
GO:0061630	ubiquitin protein ligase activity	IMP	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0030433	ubiquitin-dependent ERAD pathway	IMP	biological process
GO:0043627	response to estrogen	IDA	biological process
GO:0010494	cytoplasmic stress granule	IDA	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0039529	RIG-I signaling pathway	IMP	NOT|biological process
GO:0005515	protein binding	IPI	molecular function
GO:0039552	RIG-I binding	IPI	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016874	ligase activity	IEA	molecular function
GO:0032480	negative regulation of type I interferon production	TAS	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019985	translesion synthesis	TAS	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043627	response to estrogen	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:1902187	negative regulation of viral release from host cell	IEA	biological process
GO:0033280	response to vitamin D	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0046597	negative regulation of viral entry into host cell	IEA	biological process
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0045296	cadherin binding	HDA	molecular function
GO:0010494	cytoplasmic stress granule	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0046596	regulation of viral entry into host cell	IDA	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:1902186	regulation of viral release from host cell	IMP	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0051091	positive regulation of DNA-binding transcription factor activity	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05164	Influenza A
hsa04064	NF-kappa B signaling pathway
hsa04622	RIG-I-like receptor signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)