Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 7704
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol ZBTB16   Gene   UCSC   Ensembl
Aliases PLZF, ZNF145
Gene name zinc finger and BTB domain containing 16
Alternate names zinc finger and BTB domain-containing protein 16, promyelocytic leukaemia zinc finger, zinc finger protein 145 (Kruppel-like, expressed in promyelocytic leukemia), zinc finger protein PLZF,
Gene location 11q23.2 (114059575: 114256769)     Exons: 13     NC_000011.10
Gene summary(Entrez) This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in
OMIM 607767

Protein Summary
Protein general information Q05516  

Name: Zinc finger and BTB domain containing protein 16 (Promyelocytic leukemia zinc finger protein) (Zinc finger protein 145) (Zinc finger protein PLZF)

Length: 673  Mass: 74274

Tissue specificity: Within the hematopoietic system, PLZF is expressed in bone marrow, early myeloid cell lines and peripheral blood mononuclear cells. Also expressed in the ovary, and at lower levels, in the kidney and lung.

Sequence MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFEILFHRNSQHYTLDFL
SPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADGGAEEEEDRKA
RYLKNIFISKHSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGTLQPPAGPE
EPTLAGGGRHPGVAEVKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGPGTPTRSSVITSARELHYGRE
ESAEQVPPPAEAGQAPTGRPEHPAPPPEKHLGIYSVLPNHKADAVLSMPSSVTSGLHVQPALAVSMDFSTYGGLL
PQGFIQRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVEQHRKLHSGMKTYGCELCGKRFLDSLRLRMH
LLAHSAGAKAFVCDQCGAQFSKEDALETHRQTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNR
TFPSHTALKRHLRSHTGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEK
PFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPDWRIEKTYLYLCYV
Structural information
Protein Domains
 (34..9-)
(/note="BTB-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00037"-)
Interpro:  IPR000210  IPR011333  IPR036236  IPR013087  
Prosite:   PS50097 PS00028 PS50157

PDB:  		 1BUO 1CS3
PDBsum:   1BUO 1CS3

DIP:  
2654
MINT:  
STRING:   ENSP00000338157
Other Databases GeneCards:  ZBTB16  Malacards:  ZBTB16

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0000122 negative regulation of tr
anscription by RNA polyme
rase II
 IDA biological process
GO:0000978 RNA polymerase II cis-reg
ulatory region sequence-s
pecific DNA binding
 IDA molecular function
GO:0001227 DNA-binding transcription
repressor activity, RNA
polymerase II-specific
 IDA molecular function
GO:0001227 DNA-binding transcription
repressor activity, RNA
polymerase II-specific
 IBA molecular function
GO:0005634 nucleus
 IBA cellular component
GO:0006355 regulation of transcripti
on, DNA-templated
 IBA biological process
GO:0010468 regulation of gene expres
sion
 IBA biological process
GO:0000978 RNA polymerase II cis-reg
ulatory region sequence-s
pecific DNA binding
 IBA molecular function
GO:0045892 negative regulation of tr
anscription, DNA-template
d
 IDA biological process
GO:0016604 nuclear body
 IDA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0046872 metal ion binding
 IEA molecular function
GO:0003677 DNA binding
 IEA molecular function
GO:0005634 nucleus
 IEA cellular component
GO:0045892 negative regulation of tr
anscription, DNA-template
d
 IDA biological process
GO:0017053 transcription repressor c
omplex
 IDA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0003677 DNA binding
 IDA molecular function
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0043687 post-translational protei
n modification
 TAS biological process
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0051138 positive regulation of NK
T cell differentiation
 IEA biological process
GO:0035137 hindlimb morphogenesis
 IEA biological process
GO:0035136 forelimb morphogenesis
 IEA biological process
GO:0009952 anterior/posterior patter
n specification
 IEA biological process
GO:0008285 negative regulation of ce
ll population proliferati
on
 IEA biological process
GO:0007417 central nervous system de
velopment
 IEA biological process
GO:0001823 mesonephros development
 IEA biological process
GO:0001501 skeletal system developme
nt
 IEA biological process
GO:0034504 protein localization to n
ucleus
 IEA biological process
GO:0008022 protein C-terminus bindin
g
 IEA molecular function
GO:0005829 cytosol
 IEA cellular component
GO:0003700 DNA-binding transcription
factor activity
 IEA molecular function
GO:0003690 double-stranded DNA bindi
ng
 IEA molecular function
GO:0048133 male germ-line stem cell
asymmetric division
 IEA biological process
GO:0045638 negative regulation of my
eloid cell differentiatio
n
 IEA biological process
GO:0043065 positive regulation of ap
optotic process
 IEA biological process
GO:0035116 embryonic hindlimb morpho
genesis
 IEA biological process
GO:0030097 hemopoiesis
 IEA biological process
GO:0009880 embryonic pattern specifi
cation
 IEA biological process
GO:0006355 regulation of transcripti
on, DNA-templated
 IEA biological process
GO:0005634 nucleus
 IEA cellular component
GO:0042733 embryonic digit morphogen
esis
 IEA biological process
GO:0035116 embryonic hindlimb morpho
genesis
 IEA biological process
GO:0019904 protein domain specific b
inding
 IEA molecular function
GO:0005886 plasma membrane
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0016604 nuclear body
 IEA cellular component
GO:0016567 protein ubiquitination
 IEA biological process
GO:0051216 cartilage development
 IDA biological process
GO:0045778 positive regulation of os
sification
 IDA biological process
GO:0042803 protein homodimerization
activity
 IDA molecular function
GO:0030097 hemopoiesis
 IDA biological process
GO:0016607 nuclear speck
 IDA cellular component
GO:0016605 PML body
 IDA cellular component
GO:0061036 positive regulation of ca
rtilage development
 IDA biological process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 IDA biological process
GO:0016604 nuclear body
 IDA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0045892 negative regulation of tr
anscription, DNA-template
d
 NAS biological process
GO:0045600 positive regulation of fa
t cell differentiation
 IMP biological process
GO:0030099 myeloid cell differentiat
ion
 TAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0003677 DNA binding
 NAS molecular function
GO:0007417 central nervous system de
velopment
 ISS biological process
GO:0001823 mesonephros development
 ISS biological process
GO:0045638 negative regulation of my
eloid cell differentiatio
n
 ISS biological process
GO:0032332 positive regulation of ch
ondrocyte differentiation
 IMP biological process
GO:0030097 hemopoiesis
 TAS biological process
GO:0006915 apoptotic process
 NAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0032991 protein-containing comple
x
 IMP cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05200Pathways in cancer
hsa05202Transcriptional misregulation in cancer
hsa05221Acute myeloid leukemia

Diseases

Expand All | Collapse All
Associated diseases References
Acute myeloid leukemia KEGG:H00003
Skeletal defects, genital hypoplasia, and mental retardation KEGG:H00969
Acute myeloid leukemia KEGG:H00003
Skeletal defects, genital hypoplasia, and mental retardation KEGG:H00969
Acute promyelocytic leukemia PMID:8387545
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Cryptorchidism MIK: 28606200

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract
28606200 Cryptorchi
dism
Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
 Male infertility MeDIP-Seq
 Show abstract