• Gene id: 767558

Gene Summary

• Gene Symbol: LUZP6   Gene   UCSC   Ensembl
• Aliases: MPD6, MTPNUT
• Gene name: leucine zipper protein 6
• Alternate names: leucine zipper protein 6, myeloproliferative disease-associated 6 kDa antigen, myeloproliferative disease-associated SEREX antigen, myeloproliferative disease-associated antigen, 6-kD, myotrophin 3'UTR transcript,
• Gene location: 7q33 (135977358: 135926759)     Exons: 4     NC_000007.14
• Gene summary(Entrez): A bi-cistronic transcript encodes the products of both the myotrophin and leucine zipper protein 6 genes, which are located on chromosome 7. A cryptic ORF at the 3' end of the myotrophin transcript uses a novel internal ribosome entry site and a non-AUG t
• OMIM: 611050

Protein Summary

• Protein general information: Q538Z0  
  • Name: Leucine zipper protein 6 (Myeloproliferative disease associated 6 kDa antigen)
  • Length: 58  
  • Mass: 6437
  • Tissue specificity: Widely expressed, highest levels found in brain, placenta, spleen, testis, and ovary. Up-regulated in some tumor cells. {ECO
• Sequence:

  MKSVISYALYQVQTGSLPVYSSVLTKSPLQLQTVIYRLIVQIQHLNIPSSSSTHSSPF

• Structural information:
  • STRING: ENSP00000468007
• Other Databases: GeneCards:  LUZP6  Malacards:  LUZP6

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)