About Us

Search Result


Gene id 7554
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol ZNF8   Gene   UCSC   Ensembl
Aliases HF.18, Zfp128
Gene name zinc finger protein 8
Alternate names zinc finger protein 8, zinc finger protein 272, zinc finger protein 8 (clone HF.18), zinc finger protein HF.18,
Gene location 19q13.43 (58278954: 58302790)     Exons: 4     NC_000019.10

Protein Summary

Protein general information P17098  

Name: Zinc finger protein 8 (Zinc finger protein HF.18)

Length: 575  Mass: 64970

Tissue specificity: Ubiquitously present in many human cell lines of different embryological derivation. {ECO

Sequence MDPEDEGVAGVMSVGPPAARLQEPVTFRDVAVDFTQEEWGQLDPTQRILYRDVMLETFGHLLSIGPELPKPEVIS
QLEQGTELWVAERGTTQGCHPAWEPRSESQASRKEEGLPEEEPSHVTGREGFPTDAPYPTTLGKDRECQSQSLAL
KEQNNLKQLEFGLKEAPVQDQGYKTLRLRENCVLSSSPNPFPEISRGEYLYTYDSQITDSEHNSSLVSQQTGSPG
KQPGENSDCHRDSSQAIPITELTKSQVQDKPYKCTDCGKSFNHNAHLTVHKRIHTGERPYMCKECGKAFSQNSSL
VQHERIHTGDKPYKCAECGKSFCHSTHLTVHRRIHTGEKPYECQDCGRAFNQNSSLGRHKRTHTGEKPYTCSVCG
KSFSRTTCLFLHLRTHTEERPYECNHCGKGFRHSSSLAQHQRKHAGEKPFECRQRLIFEQTPALTKHEWTEALGC
DPPLSQDERTHRSDRPFKCNQCGKCFIQSSHLIRHQITHTREEQPHGRSRRREQSSSRNSHLVQHQHPNSRKSSA
GGAKAGQPESRALALFDIQKIMQEKNPVHVIGVEEPSVGASMLFDIREST
Structural information
Protein Domains
(25..9-)
(/note="KRAB-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00119"-)
Interpro:  IPR001909  IPR036051  IPR036236  IPR013087  
Prosite:   PS50805 PS00028 PS50157
CDD:   cd07765
STRING:   ENSP00000477716
Other Databases GeneCards:  ZNF8  Malacards:  ZNF8

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0000122 negative regulation of tr
anscription by RNA polyme
rase II
IBA biological process
GO:0003676 nucleic acid binding
IEA molecular function
GO:0006355 regulation of transcripti
on, DNA-templated
IEA biological process
GO:0046872 metal ion binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0003677 DNA binding
IEA molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0030509 BMP signaling pathway
IEA biological process
GO:0005634 nucleus
IEA cellular component
GO:0000122 negative regulation of tr
anscription by RNA polyme
rase II
IEA biological process
GO:0005634 nucleus
IEA cellular component
GO:0008270 zinc ion binding
NAS molecular function
GO:0003677 DNA binding
NAS molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05168Herpes simplex virus 1 infection
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Cryptorchidism MIK: 28606200
Spermatogenic defects MIK: 31037746

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract
31037746 Spermatoge
nic defect
s

28 men with az
oospermia
Male infertility Microarray
Show abstract