• Gene id: 7538

Gene Summary

• Gene Symbol: ZFP36   Gene   UCSC   Ensembl
• Aliases: G0S24, GOS24, NUP475, RNF162A, TIS11, TTP, zfp-36
• Gene name: ZFP36 ring finger protein
• Alternate names: mRNA decay activator protein ZFP36, G0/G1 switch regulatory protein 24, growth factor-inducible nuclear protein NUP475, tristetraprolin, tristetraproline, zinc finger protein 36 homolog, zinc finger protein 36, C3H type, homolog, zinc finger protein, C3H type, 3,
• Gene location: 19q13.2 (39406846: 39409406)     Exons: 2     NC_000019.10

Protein Summary

• Protein general information: P26651  
  • Name: mRNA decay activator protein ZFP36 (G0/G1 switch regulatory protein 24) (Growth factor inducible nuclear protein NUP475) (Tristetraprolin) (Zinc finger protein 36) (Zfp 36)
  • Length: 326  
  • Mass: 34003
  • Tissue specificity: Expressed in both basal and suprabasal epidermal layers (PubMed
• Sequence:

  MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTSLVEGRSCGWVPPPPG
  FAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKF
  YLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDL
  PLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFE
  AGVFAPPQPVAAPRRLPIFNRISVSE

• Structural information:
  • Interpro: IPR000571  IPR036855  
  • Prosite: PS50103
  • PDB: 4J8S
  • PDBsum: 4J8S
  • DIP: 29845
  • STRING: ENSP00000469647
• Other Databases: GeneCards:  ZFP36  Malacards:  ZFP36

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071889	14-3-3 protein binding	IDA	molecular function
GO:0032680	regulation of tumor necrosis factor production	IDA	biological process
GO:0010494	cytoplasmic stress granule	IDA	cellular component
GO:0000288	nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IDA	biological process
GO:0070935	3'-UTR-mediated mRNA stabilization	IDA	biological process
GO:0060213	positive regulation of nuclear-transcribed mRNA poly(A) tail shortening	IDA	biological process
GO:0006402	mRNA catabolic process	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0043488	regulation of mRNA stability	IDA	biological process
GO:0000178	exosome (RNase complex)	IDA	NOT|colocalizes with
GO:0098745	Dcp1-Dcp2 complex	IDA	colocalizes with
GO:0010494	cytoplasmic stress granule	IDA	cellular component
GO:0000932	P-body	IDA	cellular component
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0043488	regulation of mRNA stability	IDA	biological process
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0071356	cellular response to tumor necrosis factor	IDA	biological process
GO:0097011	cellular response to granulocyte macrophage colony-stimulating factor stimulus	IDA	biological process
GO:0044344	cellular response to fibroblast growth factor stimulus	IDA	biological process
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0003729	mRNA binding	IDA	molecular function
GO:0043488	regulation of mRNA stability	IDA	biological process
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0009611	response to wounding	IDA	biological process
GO:0000932	P-body	IDA	cellular component
GO:0043488	regulation of mRNA stability	IDA	biological process
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0071222	cellular response to lipopolysaccharide	IDA	biological process
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0061158	3'-UTR-mediated mRNA destabilization	IDA	biological process
GO:1901835	positive regulation of deadenylation-independent decapping of nuclear-transcribed mRNA	IDA	biological process
GO:0031072	heat shock protein binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0061158	3'-UTR-mediated mRNA destabilization	IDA	biological process
GO:0006402	mRNA catabolic process	IDA	biological process
GO:0061158	3'-UTR-mediated mRNA destabilization	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0061158	3'-UTR-mediated mRNA destabilization	IDA	biological process
GO:0071364	cellular response to epidermal growth factor stimulus	IDA	biological process
GO:0071385	cellular response to glucocorticoid stimulus	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0061158	3'-UTR-mediated mRNA destabilization	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0045647	negative regulation of erythrocyte differentiation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0031086	nuclear-transcribed mRNA catabolic process, deadenylation-independent decay	IDA	biological process
GO:0070578	RISC-loading complex	IDA	colocalizes with
GO:1900153	positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IDA	biological process
GO:0071222	cellular response to lipopolysaccharide	IMP	biological process
GO:0032897	negative regulation of viral transcription	IMP	biological process
GO:0038066	p38MAPK cascade	ISS	biological process
GO:0071222	cellular response to lipopolysaccharide	IMP	biological process
GO:0043488	regulation of mRNA stability	IMP	biological process
GO:0045600	positive regulation of fat cell differentiation	ISS	biological process
GO:0009611	response to wounding	ISS	biological process
GO:0043488	regulation of mRNA stability	IMP	biological process
GO:1902172	regulation of keratinocyte apoptotic process	IMP	biological process
GO:0045616	regulation of keratinocyte differentiation	IMP	biological process
GO:0051028	mRNA transport	IMP	biological process
GO:1904582	positive regulation of intracellular mRNA localization	IMP	biological process
GO:0030014	CCR4-NOT complex	ISS	colocalizes with
GO:0070063	RNA polymerase binding	ISS	molecular function
GO:2000637	positive regulation of gene silencing by miRNA	IMP	biological process
GO:1900153	positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	ISS	biological process
GO:0035278	miRNA mediated inhibition of translation	ISS	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0061158	3'-UTR-mediated mRNA destabilization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061158	3'-UTR-mediated mRNA destabilization	IMP	biological process
GO:0000165	MAPK cascade	IMP	biological process
GO:0045085	negative regulation of interleukin-2 biosynthetic process	ISS	biological process
GO:0061158	3'-UTR-mediated mRNA destabilization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010837	regulation of keratinocyte proliferation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000165	MAPK cascade	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061158	3'-UTR-mediated mRNA destabilization	IMP	biological process
GO:1904246	negative regulation of polynucleotide adenylyltransferase activity	ISS	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0051028	mRNA transport	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0031047	gene silencing by RNA	IEA	biological process
GO:0005737	cytoplasm	TAS	cellular component
GO:0006402	mRNA catabolic process	TAS	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0003729	mRNA binding	IDA	molecular function
GO:0006402	mRNA catabolic process	IDA	biological process
GO:0006402	mRNA catabolic process	IDA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043488	regulation of mRNA stability	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening	IMP	biological process
GO:0000932	P-body	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0035925	mRNA 3'-UTR AU-rich region binding	TAS	molecular function
GO:0042594	response to starvation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019957	C-C chemokine binding	IPI	molecular function
GO:0035925	mRNA 3'-UTR AU-rich region binding	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05166	Human T-cell leukemia virus 1 infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospadias	MIK: 24778562
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
24778562	Hypospadias			13 (5 controls, 8 cases)	Male infertility	Microarray