• Gene id: 7535

Gene Summary

• Gene Symbol: ZAP70   Gene   UCSC   Ensembl
• Aliases: ADMIO2, IMD48, SRK, STCD, STD, TZK, ZAP-70
• Gene name: zeta chain of T cell receptor associated protein kinase 70
• Alternate names: tyrosine-protein kinase ZAP-70, 70 kDa zeta-associated protein, 70 kDa zeta-chain associated protein, syk-related tyrosine kinase, zeta chain of T cell receptor associated protein kinase 70kDa, zeta-chain (TCR) associated protein kinase 70kDa, zeta-chain associ,
• Gene location: 2q11.2 (97712029: 97744326)     Exons: 20     NC_000002.12
• Gene summary(Entrez): This gene encodes an enzyme belonging to the protein tyrosine kinase family, and it plays a role in T-cell development and lymphocyte activation. This enzyme, which is phosphorylated on tyrosine residues upon T-cell antigen receptor (TCR) stimulation, fun
• OMIM: 176947

Protein Summary

• Protein general information: P43403  
  • Name: Tyrosine protein kinase ZAP 70 (EC 2.7.10.2) (70 kDa zeta chain associated protein) (Syk related tyrosine kinase)
  • Length: 619  
  • Mass: 69872
  • Tissue specificity: Expressed in T- and natural killer cells. Also present in early thymocytes and pro/pre B-cells. {ECO
• Sequence:

  MPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGK
  AHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQAIISQAPQVE
  KLIATTAHERMPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPE
  GTKFDTLWQLVEYLKLKADGLIYCLKEACPNSSASNASGAAAPTLPAHPSTLTHPQRRIDTLNSDGYTPEPARIT
  SPDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMRKKQIDVAIKVLKQGT
  EKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGGPLHKFLVGKREEIPVSNVAELLHQVSMGMK
  YLEEKNFVHRDLAARNVLLVNRHYAKISDFGLSKALGADDSYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSY
  GVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSL
  ASKVEGPPGSTQKAEAACA

• Structural information:
  • Protein Domains: (10..10-)
    (/note="SH2-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191-)
    (163..25-)
    (/note="SH2-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191-)
    (338..60-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU001-)
  • Interpro: IPR011009  IPR023420  IPR000719  IPR017441  IPR001245   IPR000980  IPR036860  IPR035838  IPR008266  IPR020635  IPR012234  
  • Prosite: PS00107 PS50011 PS00109 PS50001
  • CDD: cd09938
  • PDB: 1FBV 1M61 1U59 2CBL 2OQ1 2OZO 2Y1N 3ZNI 4A4B 4A4C 4K2R 4XZ0 4XZ1 5O76
  • PDBsum: 1FBV 1M61 1U59 2CBL 2OQ1 2OZO 2Y1N 3ZNI 4A4B 4A4C 4K2R 4XZ0 4XZ1 5O76
  • DIP: 38781
  • STRING: ENSP00000264972
• Other Databases: GeneCards:  ZAP70  Malacards:  ZAP70

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	TAS	cellular component
GO:0072678	T cell migration	TAS	biological process
GO:0042110	T cell activation	TAS	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	NAS	molecular function
GO:0070489	T cell aggregation	TAS	biological process
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0042113	B cell activation	TAS	biological process
GO:0030217	T cell differentiation	NAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0002250	adaptive immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0045582	positive regulation of T cell differentiation	IDA	biological process
GO:0045059	positive thymic T cell selection	IDA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0042101	T cell receptor complex	IDA	cellular component
GO:0018108	peptidyl-tyrosine phosphorylation	IMP	biological process
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001772	immunological synapse	IEA	cellular component
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005911	cell-cell junction	IEA	cellular component
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0043366	beta selection	IEA	biological process
GO:0045059	positive thymic T cell selection	IEA	biological process
GO:0045582	positive regulation of T cell differentiation	IEA	biological process
GO:0046638	positive regulation of alpha-beta T cell differentiation	IEA	biological process
GO:0046641	positive regulation of alpha-beta T cell proliferation	IEA	biological process
GO:0046777	protein autophosphorylation	IEA	biological process
GO:0050850	positive regulation of calcium-mediated signaling	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0045060	negative thymic T cell selection	IEA	biological process
GO:0045061	thymic T cell selection	IEA	biological process
GO:0050852	T cell receptor signaling pathway	IEA	biological process
GO:0045121	membrane raft	IDA	colocalizes with
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IDA	molecular function
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006955	immune response	IDA	biological process
GO:0001784	phosphotyrosine residue binding	IMP	molecular function
GO:0001784	phosphotyrosine residue binding	IPI	molecular function
GO:0035556	intracellular signal transduction	NAS	biological process
GO:0006468	protein phosphorylation	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004713	protein tyrosine kinase activity	NAS	molecular function
GO:0005524	ATP binding	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04014	Ras signaling pathway
hsa05135	Yersinia infection
hsa04650	Natural killer cell mediated cytotoxicity
hsa04064	NF-kappa B signaling pathway
hsa04660	T cell receptor signaling pathway
hsa04659	Th17 cell differentiation
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa04658	Th1 and Th2 cell differentiation
hsa05340	Primary immunodeficiency

Diseases

Associated diseases	References
Combined immunodeficiency	KEGG:H00093
Combined immunodeficiency	KEGG:H00093
severe combined immunodeficiency	PMID:8124727
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq