Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 7532
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol YWHAG   Gene   UCSC   Ensembl
Aliases 14-3-3GAMMA, EIEE56, PPP1R170
Gene name tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma
Alternate names 14-3-3 protein gamma, KCIP-1, protein kinase C inhibitor protein 1, protein phosphatase 1, regulatory subunit 170, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide,
Gene location 7q11.23 (76358990: 76326798)     Exons: 2     NC_000007.14
Gene summary(Entrez) This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to t
OMIM 602992

Protein Summary
Protein general information P61981  

Name: 14 3 3 protein gamma (Protein kinase C inhibitor protein 1) (KCIP 1) [Cleaved into: 14 3 3 protein gamma, N terminally processed]

Length: 247  Mass: 28303

Tissue specificity: Highly expressed in brain, skeletal muscle, and heart. {ECO

Sequence MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGN
EKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESS
EKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQL
LRDNLTLWTSDQQDDDGGEGNN
Structural information
Interpro:  IPR000308  IPR023409  IPR036815  IPR023410  
Prosite:   PS00796 PS00797

PDB:  		 2B05 3UZD 4E2E 4J6S 4O46 5D3E 6A5S 6BYJ 6BYL 6BZD 6FEL 6GKF 6GKG 6S9K 6SAD
PDBsum:   2B05 3UZD 4E2E 4J6S 4O46 5D3E 6A5S 6BYJ 6BYL 6BZD 6FEL 6GKF 6GKG 6S9K 6SAD

DIP:  
33406
MINT:  
STRING:   ENSP00000306330
Other Databases GeneCards:  YWHAG  Malacards:  YWHAG

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005737 cytoplasm
 IEA cellular component
GO:1900740 positive regulation of pr
otein insertion into mito
chondrial membrane involv
ed in apoptotic signaling
pathway
 TAS biological process
GO:0097711 ciliary basal body-plasma
membrane docking
 TAS biological process
GO:0000086 G2/M transition of mitoti
c cell cycle
 TAS biological process
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0010389 regulation of G2/M transi
tion of mitotic cell cycl
e
 TAS biological process
GO:0061024 membrane organization
 TAS biological process
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0019904 protein domain specific b
inding
 IEA molecular function
GO:0098793 presynapse
 IEA cellular component
GO:0045202 synapse
 IEA cellular component
GO:0031982 vesicle
 IEA cellular component
GO:0030971 receptor tyrosine kinase
binding
 IEA molecular function
GO:0006605 protein targeting
 IEA biological process
GO:0032869 cellular response to insu
lin stimulus
 IEA biological process
GO:0005737 cytoplasm
 IEA cellular component
GO:0005739 mitochondrion
 IEA cellular component
GO:0071901 negative regulation of pr
otein serine/threonine ki
nase activity
 IEA biological process
GO:0009966 regulation of signal tran
sduction
 NAS biological process
GO:0006469 negative regulation of pr
otein kinase activity
 NAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005159 insulin-like growth facto
r receptor binding
 IPI molecular function
GO:0070062 extracellular exosome
 HDA cellular component
GO:0008426 protein kinase C inhibito
r activity
 NAS molecular function
GO:0005080 protein kinase C binding
 IPI molecular function
GO:0070062 extracellular exosome
 HDA cellular component
GO:0045664 regulation of neuron diff
erentiation
 IMP biological process
GO:0003723 RNA binding
 HDA molecular function
GO:0009966 regulation of signal tran
sduction
 NAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005925 focal adhesion
 HDA cellular component
GO:0016020 membrane
 HDA cellular component
GO:0048167 regulation of synaptic pl
asticity
 IMP biological process
GO:0070062 extracellular exosome
 HDA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04151PI3K-Akt signaling pathway
hsa05203Viral carcinogenesis
hsa04390Hippo signaling pathway
hsa05160Hepatitis C
hsa04110Cell cycle
hsa04114Oocyte meiosis

Diseases

Expand All | Collapse All
Associated diseases References
Early infantile epileptic encephalopathy KEGG:H00606
Early infantile epileptic encephalopathy KEGG:H00606
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Cryptorchidism MIK: 28606200

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract
28606200 Cryptorchi
dism
Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
 Male infertility MeDIP-Seq
 Show abstract