Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 7531
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol YWHAE   Gene   UCSC   Ensembl
Aliases 14-3-3E, HEL2, KCIP-1, MDCR, MDS
Gene name tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon
Alternate names 14-3-3 protein epsilon, 14-3-3 epsilon, epididymis luminal protein 2, mitochondrial import stimulation factor L subunit, protein kinase C inhibitor protein-1, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide, tyrosine ,
Gene location 17p13.3 (1400261: 1344274)     Exons: 6     NC_000017.11
Gene summary(Entrez) This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to t
OMIM 605066

Protein Summary
Protein general information P62258  

Name: 14 3 3 protein epsilon (14 3 3E)

Length: 255  Mass: 29174

Sequence MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGG
EDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLV
AYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLR
DNLTLWTSDMQGDGEEQNKEALQDVEDENQ
Structural information
Interpro:  IPR000308  IPR023409  IPR036815  IPR023410  
Prosite:   PS00796 PS00797

PDB:  		 2BR9 3UAL 3UBW 6EIH
PDBsum:   2BR9 3UAL 3UBW 6EIH

DIP:  
36676
MINT:  
STRING:   ENSP00000264335
Other Databases GeneCards:  YWHAE  Malacards:  YWHAE

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0044325 ion channel binding
 IPI molecular function
GO:0044325 ion channel binding
 IPI molecular function
GO:0051480 regulation of cytosolic c
alcium ion concentration
 IDA biological process
GO:0005246 calcium channel regulator
activity
 IDA molecular function
GO:0005886 plasma membrane
 IDA colocalizes with
GO:1901020 negative regulation of ca
lcium ion transmembrane t
ransporter activity
 IDA biological process
GO:1905913 negative regulation of ca
lcium ion export across p
lasma membrane
 IDA biological process
GO:0031625 ubiquitin protein ligase
binding
 IPI molecular function
GO:0046827 positive regulation of pr
otein export from nucleus
 IDA biological process
GO:0034605 cellular response to heat
 IDA biological process
GO:0000165 MAPK cascade
 IDA biological process
GO:0005737 cytoplasm
 IDA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0034504 protein localization to n
ucleus
 IMP biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0016032 viral process
 IEA biological process
GO:0005737 cytoplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0035556 intracellular signal tran
sduction
 TAS biological process
GO:0043154 negative regulation of cy
steine-type endopeptidase
activity involved in apo
ptotic process
 TAS biological process
GO:1900740 positive regulation of pr
otein insertion into mito
chondrial membrane involv
ed in apoptotic signaling
pathway
 TAS biological process
GO:0000086 G2/M transition of mitoti
c cell cycle
 TAS biological process
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0010389 regulation of G2/M transi
tion of mitotic cell cycl
e
 TAS biological process
GO:0035329 hippo signaling
 TAS biological process
GO:0061024 membrane organization
 TAS biological process
GO:0097711 ciliary basal body-plasma
membrane docking
 TAS biological process
GO:1900034 regulation of cellular re
sponse to heat
 TAS biological process
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005829 cytosol
 IEA cellular component
GO:0005871 kinesin complex
 IEA cellular component
GO:0030424 axon
 IEA cellular component
GO:0098978 glutamatergic synapse
 IEA cellular component
GO:0099072 regulation of postsynapti
c membrane neurotransmitt
er receptor levels
 IEA biological process
GO:0001764 neuron migration
 IEA biological process
GO:0006605 protein targeting
 IEA biological process
GO:0021766 hippocampus development
 IEA biological process
GO:0035308 negative regulation of pr
otein dephosphorylation
 IEA biological process
GO:0019899 enzyme binding
 IEA molecular function
GO:0044877 protein-containing comple
x binding
 IEA molecular function
GO:0045202 synapse
 IEA cellular component
GO:0090724 central region of growth
cone
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0019904 protein domain specific b
inding
 IEA molecular function
GO:0021987 cerebral cortex developme
nt
 IEA biological process
GO:0044325 ion channel binding
 IPI molecular function
GO:0051219 phosphoprotein binding
 IPI molecular function
GO:0015459 potassium channel regulat
or activity
 IDA molecular function
GO:0045296 cadherin binding
 HDA molecular function
GO:0042826 histone deacetylase bindi
ng
 IPI molecular function
GO:0042826 histone deacetylase bindi
ng
 IPI molecular function
GO:0046982 protein heterodimerizatio
n activity
 IPI molecular function
GO:0050815 phosphoserine residue bin
ding
 IPI molecular function
GO:0060306 regulation of membrane re
polarization
 IDA biological process
GO:0086013 membrane repolarization d
uring cardiac muscle cell
action potential
 IC biological process
GO:0086091 regulation of heart rate
by cardiac conduction
 IC biological process
GO:1901016 regulation of potassium i
on transmembrane transpor
ter activity
 IDA biological process
GO:1902309 negative regulation of pe
ptidyl-serine dephosphory
lation
 IDA biological process
GO:0003064 regulation of heart rate
by hormone
 NAS biological process
GO:0005634 nucleus
 IEA cellular component
GO:0042470 melanosome
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005829 cytosol
 IDA cellular component
GO:0005739 mitochondrion
 IEA cellular component
GO:0021762 substantia nigra developm
ent
 HEP biological process
GO:0005515 protein binding
 IPI molecular function
GO:0023026 MHC class II protein comp
lex binding
 HDA molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0070062 extracellular exosome
 HDA cellular component
GO:0070062 extracellular exosome
 HDA cellular component
GO:0070062 extracellular exosome
 HDA cellular component
GO:0003723 RNA binding
 HDA molecular function
GO:0019899 enzyme binding
 IPI molecular function
GO:0005925 focal adhesion
 HDA cellular component
GO:0016020 membrane
 HDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0070062 extracellular exosome
 HDA cellular component
GO:0097110 scaffold protein binding
 IPI molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04151PI3K-Akt signaling pathway
hsa05203Viral carcinogenesis
hsa04621NOD-like receptor signaling pathway
hsa04390Hippo signaling pathway
hsa05160Hepatitis C
hsa04110Cell cycle
hsa04114Oocyte meiosis
hsa04722Neurotrophin signaling pathway

Diseases

Expand All | Collapse All
Associated diseases References
Lissencephaly KEGG:H00268
Lissencephaly KEGG:H00268
Cryptorchidism MIK: 28606200
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
28606200 Cryptorchi
dism
Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
 Male infertility MeDIP-Seq
 Show abstract