Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 7529
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol YWHAB   Gene   UCSC   Ensembl
Aliases GW128, HEL-S-1, HS1, KCIP-1, YWHAA
Gene name tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta
Alternate names 14-3-3 protein beta/alpha, 14-3-3 alpha, brain protein 14-3-3, beta isoform, epididymis secretory protein Li 1, protein 1054, protein kinase C inhibitor protein-1, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, alpha polypeptide, tyrosin,
Gene location 20q13.12 (44885704: 44908531)     Exons: 8     NC_000020.11
Gene summary(Entrez) This gene encodes a protein belonging to the 14-3-3 family of proteins, members of which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals. The encoded pro
OMIM 601289

Protein Summary
Protein general information P31946  

Name: 14 3 3 protein beta/alpha (Protein 1054) (Protein kinase C inhibitor protein 1) (KCIP 1) [Cleaved into: 14 3 3 protein beta/alpha, N terminally processed]

Length: 246  Mass: 28082

Sequence MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNE
KKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQA
YQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRD
NLTLWTSENQGDEGDAGEGEN
Structural information
Interpro:  IPR000308  IPR023409  IPR036815  IPR023410  
Prosite:   PS00796 PS00797

PDB:  		 2BQ0 2C23 4DNK 5N10 6A5Q 6BYK 6GN0 6GN8 6GNJ 6GNK 6GNN 6HEP
PDBsum:   2BQ0 2C23 4DNK 5N10 6A5Q 6BYK 6GN0 6GN8 6GNJ 6GNK 6GNN 6HEP

DIP:  
743
MINT:  
STRING:   ENSP00000361930
Other Databases GeneCards:  YWHAB  Malacards:  YWHAB

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0045744 negative regulation of G
protein-coupled receptor
signaling pathway
 IMP biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005773 vacuole
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0016032 viral process
 IEA biological process
GO:0016020 membrane
 IEA cellular component
GO:0000165 MAPK cascade
 TAS biological process
GO:1900740 positive regulation of pr
otein insertion into mito
chondrial membrane involv
ed in apoptotic signaling
pathway
 TAS biological process
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0035329 hippo signaling
 TAS biological process
GO:0043488 regulation of mRNA stabil
ity
 TAS biological process
GO:0043488 regulation of mRNA stabil
ity
 TAS biological process
GO:0061024 membrane organization
 TAS biological process
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0006605 protein targeting
 IEA biological process
GO:0045892 negative regulation of tr
anscription, DNA-template
d
 IEA biological process
GO:0032991 protein-containing comple
x
 IEA cellular component
GO:0008022 protein C-terminus bindin
g
 IEA molecular function
GO:0019904 protein domain specific b
inding
 IEA molecular function
GO:0044877 protein-containing comple
x binding
 IEA molecular function
GO:0017053 transcription repressor c
omplex
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0051219 phosphoprotein binding
 IPI molecular function
GO:0045296 cadherin binding
 HDA molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0019899 enzyme binding
 IPI molecular function
GO:0042826 histone deacetylase bindi
ng
 IPI molecular function
GO:0042826 histone deacetylase bindi
ng
 IPI molecular function
GO:0050815 phosphoserine residue bin
ding
 IPI molecular function
GO:0035308 negative regulation of pr
otein dephosphorylation
 IDA biological process
GO:0051220 cytoplasmic sequestering
of protein
 IDA biological process
GO:0005737 cytoplasm
 IDA cellular component
GO:0043085 positive regulation of ca
talytic activity
 IDA biological process
GO:0005737 cytoplasm
 IEA cellular component
GO:0005774 vacuolar membrane
 IEA cellular component
GO:0042470 melanosome
 IEA cellular component
GO:0005829 cytosol
 IDA cellular component
GO:0005739 mitochondrion
 IEA cellular component
GO:0048471 perinuclear region of cyt
oplasm
 IDA cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0070062 extracellular exosome
 HDA cellular component
GO:0005925 focal adhesion
 HDA cellular component
GO:0016020 membrane
 HDA cellular component
GO:0019904 protein domain specific b
inding
 IPI molecular function
GO:0070062 extracellular exosome
 HDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04151PI3K-Akt signaling pathway
hsa05203Viral carcinogenesis
hsa04390Hippo signaling pathway
hsa05161Hepatitis B
hsa05160Hepatitis C
hsa04110Cell cycle
hsa04114Oocyte meiosis
P06959CCKR signaling map

Diseases

Expand All | Collapse All
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Teratozoospermia MIK: 17327269
Unexplained infertility MIK: 25753583

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract
25753583 Unexplaine
d infertil
ity
46 (17 fertile
men, 29 male pa
tients)
 Male infertility Microarray
 Show abstract