• Gene id: 752014

Gene Summary

• Gene Symbol: CEMP1   Gene   UCSC   Ensembl
• Aliases: CP-23, CP23
• Gene name: cementum protein 1
• Alternate names: cementoblastoma-derived protein 1, cementum protein 23,
• Gene location: 16p13.3 (2531407: 2530034)     Exons: 1     NC_000016.10
• OMIM: 611113

Protein Summary

• Protein general information: Q6PRD7  
  • Name: Cementoblastoma derived protein 1 (Cementum protein 1) (Cementum protein 23) (CP 23)
  • Length: 247  
  • Mass: 25959
  • Tissue specificity: Expressed by cementoblasts, a subpopulation of periodontal ligament cells and cells located around vessels in periodontium (at protein level). {ECO
• Sequence:

  MGTSSTDSQQAGHRRCSTSNTSAENLTCLSLPGSPGKTAPLPGPAQAGAGQPLPKGCAAVKAEVGIPAPHTSQEV
  RIHIRRLLSWAAPGACGLRSTPCALPQALPQARPCPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENS
  GRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTITPDVGLHQSLTSDPTVAVLRAKRAPEAHPPRSCSGSLTAR
  VCHMGVCQGQGDTEDGRMTLMG

• Structural information:
  • STRING: ENSP00000457380
• Other Databases: GeneCards:  CEMP1  Malacards:  CEMP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031214	biomineral tissue development	IDA	biological process
GO:0031214	biomineral tissue development	IDA	biological process
GO:0008283	cell population proliferation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0042476	odontogenesis	IDA	biological process
GO:0008283	cell population proliferation	IDA	biological process
GO:0046848	hydroxyapatite binding	IDA	molecular function
GO:0030154	cell differentiation	IMP	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq