• Gene id: 7517

Gene Summary

• Gene Symbol: XRCC3   Gene   UCSC   Ensembl
• Aliases: CMM6
• Gene name: X-ray repair cross complementing 3
• Alternate names: DNA repair protein XRCC3, X-ray repair complementing defective repair in Chinese hamster cells 3, X-ray repair cross-complementing protein 3,
• Gene location: 14q32.33 (103715485: 103697610)     Exons: 10     NC_000014.9
• Gene summary(Entrez): This gene encodes a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene functionally complements Chinese hamster irs1SF, a repair-deficient mutant

Protein Summary

• Protein general information: O43542  
  • Name: DNA repair protein XRCC3 (X ray repair cross complementing protein 3)
  • Length: 346  
  • Mass: 37850
• Sequence:

  MDLDLLDLNPRIIAAIKKAKLKSVKEVLHFSGPDLKRLTNLSSPEVWHLLRTASLHLRGSSILTALQLHQQKERF
  PTQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQFPRQHGGLEAGAVYICTEDAFPHKR
  LQQLMAQQPRLRTDVPGELLQKLRFGSQIFIEHVADVDTLLECVNKKVPVLLSRGMARLVVIDSVAAPFRCEFDS
  QASAPRARHLQSLGATLRELSSAFQSPVLCINQVTEAMEEQGAAHGPLGFWDERVSPALGITWANQLLVRLLADR
  LREEEAALGCPARTLRVLSAPHLPPSSCSYTISAEGVRGTPGTQSH

• Structural information:
  • Interpro: IPR013632  IPR016467  IPR027417  IPR033925  IPR020588  
  • Prosite: PS50162
  • CDD: cd01123
  • DIP: 42016
  • STRING: ENSP00000451974
• Other Databases: GeneCards:  XRCC3  Malacards:  XRCC3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0036297	interstrand cross-link repair	IMP	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0000400	four-way junction DNA binding	IBA	contributes to
GO:0000722	telomere maintenance via recombination	IBA	biological process
GO:0005657	replication fork	IBA	cellular component
GO:0045003	double-strand break repair via synthesis-dependent strand annealing	IBA	biological process
GO:0008821	crossover junction endodeoxyribonuclease activity	IBA	contributes to
GO:0033065	Rad51C-XRCC3 complex	IBA	cellular component
GO:0071140	resolution of mitotic recombination intermediates	IBA	biological process
GO:0090656	t-circle formation	IBA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0033065	Rad51C-XRCC3 complex	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005657	replication fork	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000400	four-way junction DNA binding	IDA	contributes to
GO:0090267	positive regulation of mitotic cell cycle spindle assembly checkpoint	IMP	biological process
GO:0071140	resolution of mitotic recombination intermediates	IMP	biological process
GO:0008821	crossover junction endodeoxyribonuclease activity	IMP	contributes to
GO:0008821	crossover junction endodeoxyribonuclease activity	IMP	contributes to
GO:0010824	regulation of centrosome duplication	IMP	biological process
GO:0000724	double-strand break repair via homologous recombination	IMP	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0008094	DNA-dependent ATPase activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0006310	DNA recombination	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0006281	DNA repair	TAS	biological process
GO:0006310	DNA recombination	TAS	biological process
GO:0006974	cellular response to DNA damage stimulus	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010033	response to organic substance	IEA	biological process
GO:0000784	nuclear chromosome, telomeric region	IC	cellular component
GO:0090656	t-circle formation	IMP	biological process
GO:0090656	t-circle formation	IC	biological process
GO:0000722	telomere maintenance via recombination	IMP	biological process
GO:0006281	DNA repair	IGI	biological process
GO:0090657	telomeric loop disassembly	TAS	biological process
GO:0090737	telomere maintenance via telomere trimming	IGI	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03440	Homologous recombination

Diseases

Associated diseases	References
pancreatic cancer	PMID:18559563
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq