• Gene id: 7516

Gene Summary

• Gene Symbol: XRCC2   Gene   UCSC   Ensembl
• Aliases: FANCU
• Gene name: X-ray repair cross complementing 2
• Alternate names: DNA repair protein XRCC2, X-ray repair complementing defective repair in Chinese hamster cells 2, X-ray repair cross-complementing protein 2, epididymis secretory sperm binding protein,
• Gene location: 7q36.1 (152676140: 152644775)     Exons: 3     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombi
• OMIM: 600375

Protein Summary

• Protein general information: O43543  
  • Name: DNA repair protein XRCC2 (X ray repair cross complementing protein 2)
  • Length: 280  
  • Mass: 31956
• Sequence:

  MCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKSEGGLE
  VEVLFIDTDYHFDMLRLVTILEHRLSQSSEEIIKYCLGRFFLVYCSSSTHLLLTLYSLESMFCSHPSLCLLILDS
  LSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFATTQTIMQKASSSSEEPSHASRRLCDVDIDYRP
  YLCKAWQQLVKHRMFFSKQDDSQSSNQFSLVSRCLKSNSLKKHFFIIGESGVEFC

• Structural information:
  • Interpro: IPR013632  IPR027417  IPR020588  IPR030547  
  • Prosite: PS50162
  • DIP: 24242
  • STRING: ENSP00000352271
• Other Databases: GeneCards:  XRCC2  Malacards:  XRCC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000400	four-way junction DNA binding	IBA	contributes to
GO:0000724	double-strand break repair via homologous recombination	IBA	biological process
GO:0005657	replication fork	IBA	cellular component
GO:0005813	centrosome	IBA	cellular component
GO:0033063	Rad51B-Rad51C-Rad51D-XRCC2 complex	IBA	cellular component
GO:0042148	strand invasion	IBA	biological process
GO:0042148	strand invasion	IDA	biological process
GO:0033063	Rad51B-Rad51C-Rad51D-XRCC2 complex	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005657	replication fork	IDA	cellular component
GO:0000400	four-way junction DNA binding	IDA	contributes to
GO:0000278	mitotic cell cycle	IMP	biological process
GO:0007098	centrosome cycle	IMP	biological process
GO:0000724	double-strand break repair via homologous recombination	IMP	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0008094	DNA-dependent ATPase activity	IEA	molecular function
GO:0033063	Rad51B-Rad51C-Rad51D-XRCC2 complex	IEA	cellular component
GO:0000724	double-strand break repair via homologous recombination	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005657	replication fork	IEA	cellular component
GO:0006281	DNA repair	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006310	DNA recombination	IEA	biological process
GO:0006281	DNA repair	TAS	biological process
GO:0051321	meiotic cell cycle	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050769	positive regulation of neurogenesis	IEA	biological process
GO:0022008	neurogenesis	IEA	biological process
GO:0010332	response to gamma radiation	IEA	biological process
GO:0010165	response to X-ray	IEA	biological process
GO:2000269	regulation of fibroblast apoptotic process	IEA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0035264	multicellular organism growth	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0001756	somitogenesis	IEA	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0000724	double-strand break repair via homologous recombination	IEA	biological process
GO:0006281	DNA repair	IGI	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03440	Homologous recombination

Diseases

Associated diseases	References
Fanconi anemia	KEGG:H00238
Fanconi anemia	KEGG:H00238
pancreatic cancer	PMID:16540687
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia	MIK: 30042186
Male infertility	MIK: 30042186
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
30042186	Meiotic arrest, azoospermia, male infertility	c.41T>C/p.Leu14Pro	Han Chi nese, C hinese Tujia M iao	127 cases of non-obstructive azoospermia	Male infertility	NGS
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R