• Gene id: 7514

Gene Summary

• Gene Symbol: XPO1   Gene   UCSC   Ensembl
• Aliases: CRM-1, CRM1, emb, exp1
• Gene name: exportin 1
• Alternate names: exportin-1, chromosome region maintenance 1 homolog, chromosome region maintenance 1 protein homolog, exportin 1 (CRM1 homolog, yeast), exportin-1 (required for chromosome region maintenance),
• Gene location: 2p15 (61538521: 61477848)     Exons: 31     NC_000002.12
• Gene summary(Entrez): This cell-cycle-regulated gene encodes a protein that mediates leucine-rich nuclear export signal (NES)-dependent protein transport. The protein specifically inhibits the nuclear export of Rev and U snRNAs. It is involved in the control of several cellula
• OMIM: 602559

Protein Summary

• Protein general information: O14980  
  • Name: Exportin 1 (Exp1) (Chromosome region maintenance 1 protein homolog)
  • Length: 1071  
  • Mass: 123386
  • Tissue specificity: Expressed in heart, brain, placenta, lung, liver, skeletal muscle, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocytes. Not expressed in the kidney. {ECO
• Sequence:

  MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNT
  KYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFI
  SDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHAT
  LETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPL
  NTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNH
  LAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDS
  INLYKNMRETLVYLTHLDYVDTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLL
  GLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFV
  QVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKN
  VDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRT
  VKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDA
  VFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTL
  LQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTSLNPGNPVNNQIFLQ
  EYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKH
  KRQMSVPGIFNPHEIPEEMCD

• Structural information:
  • Protein Domains: (46..11-)
    (/note="Importin-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00115"-)
  • Interpro: IPR011989  IPR016024  IPR041123  IPR041235  IPR013598   IPR001494  IPR014877  IPR040485  
  • Prosite: PS50166
  • PDB: 1W9C 2L1L 3GB8 4BSM 4BSN 5DIS
  • PDBsum: 1W9C 2L1L 3GB8 4BSM 4BSN 5DIS
  • DIP: 33678
  • STRING: ENSP00000384863
• Other Databases: GeneCards:  XPO1  Malacards:  XPO1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006611	protein export from nucleus	IC	biological process
GO:0006611	protein export from nucleus	IMP	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0005049	nuclear export signal receptor activity	IMP	molecular function
GO:0005049	nuclear export signal receptor activity	IMP	molecular function
GO:0005049	nuclear export signal receptor activity	IMP	molecular function
GO:0042254	ribosome biogenesis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0000056	ribosomal small subunit export from nucleus	IMP	biological process
GO:0000055	ribosomal large subunit export from nucleus	IMP	biological process
GO:0000054	ribosomal subunit export from nucleus	IMP	biological process
GO:0000056	ribosomal small subunit export from nucleus	IBA	biological process
GO:0005049	nuclear export signal receptor activity	IBA	molecular function
GO:0046825	regulation of protein export from nucleus	IBA	biological process
GO:0000055	ribosomal large subunit export from nucleus	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0000776	kinetochore	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005049	nuclear export signal receptor activity	IEA	molecular function
GO:0006886	intracellular protein transport	IEA	biological process
GO:0008536	Ran GTPase binding	IEA	molecular function
GO:0051028	mRNA transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0006611	protein export from nucleus	IMP	biological process
GO:0016032	viral process	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043488	regulation of mRNA stability	TAS	biological process
GO:0075733	intracellular transport of virus	TAS	biological process
GO:0075733	intracellular transport of virus	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0042493	response to drug	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0010824	regulation of centrosome duplication	IEA	biological process
GO:0042176	regulation of protein catabolic process	IEA	biological process
GO:0006611	protein export from nucleus	IEA	biological process
GO:0005049	nuclear export signal receptor activity	IEA	molecular function
GO:0006611	protein export from nucleus	IEA	biological process
GO:0034504	protein localization to nucleus	IEA	biological process
GO:0046825	regulation of protein export from nucleus	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0015030	Cajal body	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006611	protein export from nucleus	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043657	host cell	IEA	cellular component
GO:0043657	host cell	IEA	cellular component
GO:0005642	annulate lamellae	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0006611	protein export from nucleus	IDA	biological process
GO:0032434	regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005049	nuclear export signal receptor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0006913	nucleocytoplasmic transport	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006611	protein export from nucleus	IPI	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05166	Human T-cell leukemia virus 1 infection
hsa03013	RNA transport
hsa05164	Influenza A
hsa03008	Ribosome biogenesis in eukaryotes

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)