• Gene id: 7507

Gene Summary

• Gene Symbol: XPA   Gene   UCSC   Ensembl
• Aliases: XP1, XPAC
• Gene name: XPA, DNA damage recognition and repair factor
• Alternate names: DNA repair protein complementing XP-A cells, xeroderma pigmentosum group A-complementing protein, xeroderma pigmentosum, complementation group A,
• Gene location: 9q22.33 (97697408: 97654397)     Exons: 9     NC_000009.12
• Gene summary(Entrez): This gene encodes a zinc finger protein plays a central role in nucleotide excision repair (NER), a specialized type of DNA repair. NER is responsible for repair of UV radiation-induced photoproducts and DNA adducts induced by chemical carcinogens and che
• OMIM: 611153

Protein Summary

• Protein general information: P23025  
  • Name: DNA repair protein complementing XP A cells (Xeroderma pigmentosum group A complementing protein)
  • Length: 273  
  • Mass: 31,368
• Sequence:

  MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGF
  ILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLL
  KDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKE
  LRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM

• Structural information:
  • Interpro: IPR009061  IPR000465  IPR022656  IPR022658  IPR037129   IPR022652  
  • Prosite: PS00752 PS00753
  • PDB: 1D4U 1XPA 2JNW
  • PDBsum: 1D4U 1XPA 2JNW
  • DIP: 24191
  • STRING: ENSP00000364270
• Other Databases: GeneCards:  XPA  Malacards:  XPA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000110	nucleotide-excision repair factor 1 complex	IBA	cellular component
GO:0000715	nucleotide-excision repair, DNA damage recognition	IBA	biological process
GO:0000717	nucleotide-excision repair, DNA duplex unwinding	TAS	biological process
GO:0003684	damaged DNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0006281	DNA repair	TAS	biological process
GO:0006283	transcription-coupled nucleotide-excision repair	TAS	biological process
GO:0006284	base-excision repair	IBA	biological process
GO:0006293	nucleotide-excision repair, preincision complex stabilization	TAS	biological process
GO:0006294	nucleotide-excision repair, preincision complex assembly	TAS	biological process
GO:0006294	nucleotide-excision repair, preincision complex assembly	TAS	biological process
GO:0006295	nucleotide-excision repair, DNA incision, 3'-to lesion	TAS	biological process
GO:0006296	nucleotide-excision repair, DNA incision, 5'-to lesion	TAS	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IEA	biological process
GO:0009636	response to toxic substance	IEA	biological process
GO:0010996	response to auditory stimulus	IEA	biological process
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0033683	nucleotide-excision repair, DNA incision	IMP	biological process
GO:0033683	nucleotide-excision repair, DNA incision	TAS	biological process
GO:0035264	multicellular organism growth	IEA	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0045171	intercellular bridge	IDA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0070911	global genome nucleotide-excision repair	TAS	biological process
GO:0070914	UV-damage excision repair	IBA	biological process
GO:1901255	nucleotide-excision repair involved in interstrand cross-link repair	IBA	biological process
GO:0005662	DNA replication factor A complex	IDA	cellular component
GO:0000110	nucleotide-excision repair factor 1 complex	IBA	cellular component
GO:0000715	nucleotide-excision repair, DNA damage recognition	IBA	biological process
GO:0000717	nucleotide-excision repair, DNA duplex unwinding	TAS	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003684	damaged DNA binding	IEA	molecular function
GO:0003684	damaged DNA binding	TAS	molecular function
GO:0003684	damaged DNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0006281	DNA repair	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0006281	DNA repair	TAS	biological process
GO:0006283	transcription-coupled nucleotide-excision repair	TAS	biological process
GO:0006284	base-excision repair	IBA	biological process
GO:0006289	nucleotide-excision repair	IEA	biological process
GO:0006289	nucleotide-excision repair	IEA	biological process
GO:0006293	nucleotide-excision repair, preincision complex stabilization	TAS	biological process
GO:0006294	nucleotide-excision repair, preincision complex assembly	TAS	biological process
GO:0006294	nucleotide-excision repair, preincision complex assembly	TAS	biological process
GO:0006295	nucleotide-excision repair, DNA incision, 3'-to lesion	TAS	biological process
GO:0006296	nucleotide-excision repair, DNA incision, 5'-to lesion	TAS	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IEA	biological process
GO:0009411	response to UV	IEA	biological process
GO:0009636	response to toxic substance	IEA	biological process
GO:0010996	response to auditory stimulus	IEA	biological process
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0033683	nucleotide-excision repair, DNA incision	IMP	biological process
GO:0033683	nucleotide-excision repair, DNA incision	TAS	biological process
GO:0035264	multicellular organism growth	IEA	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0045171	intercellular bridge	IDA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0070911	global genome nucleotide-excision repair	TAS	biological process
GO:0070914	UV-damage excision repair	IBA	biological process
GO:1901255	nucleotide-excision repair involved in interstrand cross-link repair	IBA	biological process
GO:0005662	DNA replication factor A complex	IDA	cellular component
GO:0000110	nucleotide-excision repair factor 1 complex	IBA	cellular component
GO:0000715	nucleotide-excision repair, DNA damage recognition	IBA	biological process
GO:0000717	nucleotide-excision repair, DNA duplex unwinding	TAS	biological process
GO:0003684	damaged DNA binding	TAS	molecular function
GO:0003684	damaged DNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0006281	DNA repair	TAS	biological process
GO:0006283	transcription-coupled nucleotide-excision repair	TAS	biological process
GO:0006284	base-excision repair	IBA	biological process
GO:0006293	nucleotide-excision repair, preincision complex stabilization	TAS	biological process
GO:0006294	nucleotide-excision repair, preincision complex assembly	TAS	biological process
GO:0006294	nucleotide-excision repair, preincision complex assembly	TAS	biological process
GO:0006295	nucleotide-excision repair, DNA incision, 3'-to lesion	TAS	biological process
GO:0006296	nucleotide-excision repair, DNA incision, 5'-to lesion	TAS	biological process
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0033683	nucleotide-excision repair, DNA incision	IMP	biological process
GO:0033683	nucleotide-excision repair, DNA incision	TAS	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0045171	intercellular bridge	IDA	cellular component
GO:0070911	global genome nucleotide-excision repair	TAS	biological process
GO:0070914	UV-damage excision repair	IBA	biological process
GO:1901255	nucleotide-excision repair involved in interstrand cross-link repair	IBA	biological process
GO:0005662	DNA replication factor A complex	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04064	NF-kappa B signaling pathway
hsa01524	Platinum drug resistance

Diseases

Associated diseases	References
Cancer	GAD: 18204222
Cancer (Adenocarcinoma)	GAD: 19332728
Cancer (Aerodigestive tract)	GAD: 17040931
Cancer (basal cell)	GAD: 17687452
Cancer (esophageal)	GAD: 19173862
Cancer (head and neck)	GAD: 20429839
Cancer (laryngeal)	GAD: 19444904
Cancer (leiomyoma)	GAD: 20651370
Cancer (leukemia)	GAD: 20575039
Cancer (lung)	GAD: 12376498
Cancer (lymphoma)	GAD: 19954624
Cancer (mouth)	GAD: 18442012
Cancer (oral premalignant lesions)	GAD: 17575242
Cancer (oral)	GAD: 16393248
Cancer (ovarian)	GAD: 17825393
Cancer (pancreatic)	GAD: 18559563
Cancer (Renal cell)	GAD: 18711149
Cancer (Squamous cell)	GAD: 20128036
Cancer (bladder)	GAD: 15746040
Cancer (colorectal)	GAD: 8973600
Cancer (breast)	GAD: 20496165
Cancer (endometrial)	GAD: 16284373
Xeroderma pigmentosum	KEGG: H01428
Pterygium	GAD: 20431719
Neutropenia	GAD: 19074750
Multiple sclerosis	GAD: 20522537
Bone diseases	GAD: 19434073
Sperm DNA fragmentation	MIK: 20864414
Disorders of nucleotide excision repair	KEGG: H00403
Sperm DNA fragmentation	MIK: 20864414
Male infertility	MIK: 20864414
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
20864414	Sperm DNA fragmentation, Male infertility	XPA(-4) G/A, ERCC1 C8092A, XPD Lys751Gln and XPF Ser835Ser		1005 (620 patients, 385 controls)	Male infertilityz	XPA ERCC1  XPD XPF
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)