• Gene id: 7494

Gene Summary

• Gene Symbol: XBP1   Gene   UCSC   Ensembl
• Aliases: TREB-5, TREB5, XBP-1, XBP2
• Gene name: X-box binding protein 1
• Alternate names: X-box-binding protein 1, tax-responsive element-binding protein 5,
• Gene location: 22q12 (45671797: 45845306)     Exons: 12     NC_000022.11
• Gene summary(Entrez): This gene encodes a transcription factor that regulates MHC class II genes by binding to a promoter element referred to as an X box. This gene product is a bZIP protein, which was also identified as a cellular transcription factor that binds to an enhance
• OMIM: 194355

Protein Summary

• Protein general information: P17861  
  • Name: X box binding protein 1 (XBP 1) (Tax responsive element binding protein 5) (TREB 5) [Cleaved into: X box binding protein 1, cytoplasmic form; X box binding protein 1, luminal form]
  • Length: 261  
  • Mass: 28695
  • Tissue specificity: Expressed in plasma cells in rheumatoid synovium (PubMed
• Sequence:

  MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARKRQRLTHLSPEEKALR
  RKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLREKTHGLVVENQELRQRLGMDALVAEEEAEA
  KGNEVRPVAGSAESAALRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLP
  AWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN

• Structural information:
  • Protein Domains: (70..13-)
    (/note="bZIP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00978"-)
  • Interpro: IPR004827  
  • Prosite: PS50217 PS00036
  • PDB: 6R5Q 6R6G 6R6P 6R7Q
  • PDBsum: 6R5Q 6R6G 6R6P 6R7Q
  • DIP: 41692
  • STRING: ENSP00000216037
• Other Databases: GeneCards:  XBP1  Malacards:  XBP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0006633	fatty acid biosynthetic process	TAS	biological process
GO:1902236	negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IDA	biological process
GO:0006955	immune response	TAS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0036498	IRE1-mediated unfolded protein response	TAS	biological process
GO:0036498	IRE1-mediated unfolded protein response	TAS	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0006366	transcription by RNA polymerase II	IBA	biological process
GO:0030176	integral component of endoplasmic reticulum membrane	IBA	cellular component
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006990	positive regulation of transcription from RNA polymerase II promoter involved in unfolded protein response	IBA	biological process
GO:1900103	positive regulation of endoplasmic reticulum unfolded protein response	IBA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0002639	positive regulation of immunoglobulin production	IDA	biological process
GO:1900100	positive regulation of plasma cell differentiation	IDA	biological process
GO:0045582	positive regulation of T cell differentiation	IDA	biological process
GO:0071222	cellular response to lipopolysaccharide	IDA	biological process
GO:0000987	cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0046982	protein heterodimerization activity	IDA	molecular function
GO:0045579	positive regulation of B cell differentiation	IDA	biological process
GO:0001525	angiogenesis	ISS	biological process
GO:0030968	endoplasmic reticulum unfolded protein response	ISS	biological process
GO:0071230	cellular response to amino acid stimulus	ISS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	ISS	biological process
GO:0071333	cellular response to glucose stimulus	ISS	biological process
GO:0055092	sterol homeostasis	ISS	biological process
GO:0042632	cholesterol homeostasis	ISS	biological process
GO:0035356	cellular triglyceride homeostasis	ISS	biological process
GO:0010832	negative regulation of myotube differentiation	ISS	biological process
GO:0006366	transcription by RNA polymerase II	ISS	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS	molecular function
GO:0042149	cellular response to glucose starvation	ISS	biological process
GO:0032869	cellular response to insulin stimulus	ISS	biological process
GO:2000347	positive regulation of hepatocyte proliferation	ISS	biological process
GO:0043066	negative regulation of apoptotic process	ISS	biological process
GO:1903489	positive regulation of lactation	ISS	biological process
GO:0060612	adipose tissue development	ISS	biological process
GO:0045600	positive regulation of fat cell differentiation	ISS	biological process
GO:0045348	positive regulation of MHC class II biosynthetic process	IMP	biological process
GO:0048666	neuron development	ISS	biological process
GO:0071332	cellular response to fructose stimulus	ISS	biological process
GO:0055089	fatty acid homeostasis	ISS	biological process
GO:1990418	response to insulin-like growth factor stimulus	ISS	biological process
GO:0031670	cellular response to nutrient	ISS	biological process
GO:0071353	cellular response to interleukin-4	ISS	biological process
GO:2000778	positive regulation of interleukin-6 secretion	ISS	biological process
GO:0051024	positive regulation of immunoglobulin secretion	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0001889	liver development	ISS	biological process
GO:0071375	cellular response to peptide hormone stimulus	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0006990	positive regulation of transcription from RNA polymerase II promoter involved in unfolded protein response	ISS	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0007517	muscle organ development	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0006986	response to unfolded protein	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0003677	DNA binding	TAS	molecular function
GO:0006955	immune response	TAS	biological process
GO:0036498	IRE1-mediated unfolded protein response	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0036500	ATF6-mediated unfolded protein response	TAS	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA	molecular function
GO:0001889	liver development	IEA	biological process
GO:0001935	endothelial cell proliferation	IEA	biological process
GO:0002070	epithelial cell maturation	IEA	biological process
GO:0006990	positive regulation of transcription from RNA polymerase II promoter involved in unfolded protein response	IEA	biological process
GO:0031017	exocrine pancreas development	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0055089	fatty acid homeostasis	IEA	biological process
GO:0071353	cellular response to interleukin-4	IEA	biological process
GO:0071375	cellular response to peptide hormone stimulus	IEA	biological process
GO:1990418	response to insulin-like growth factor stimulus	IEA	biological process
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0010506	regulation of autophagy	IEA	biological process
GO:0031648	protein destabilization	IEA	biological process
GO:0035356	cellular triglyceride homeostasis	IEA	biological process
GO:0042149	cellular response to glucose starvation	IEA	biological process
GO:0042632	cholesterol homeostasis	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0045600	positive regulation of fat cell differentiation	IEA	biological process
GO:0055092	sterol homeostasis	IEA	biological process
GO:0060612	adipose tissue development	IEA	biological process
GO:0060691	epithelial cell maturation involved in salivary gland development	IEA	biological process
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA	biological process
GO:0071230	cellular response to amino acid stimulus	IEA	biological process
GO:1903489	positive regulation of lactation	IEA	biological process
GO:2000347	positive regulation of hepatocyte proliferation	IEA	biological process
GO:0035470	positive regulation of vascular wound healing	IDA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IGI	biological process
GO:0045766	positive regulation of angiogenesis	IMP	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:1900103	positive regulation of endoplasmic reticulum unfolded protein response	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa05012	Parkinson disease
hsa04141	Protein processing in endoplasmic reticulum
hsa05017	Spinocerebellar ataxia
hsa04932	Non-alcoholic fatty liver disease

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)