• Gene id: 7490

Gene Summary

• Gene Symbol: WT1   Gene   UCSC   Ensembl
• Aliases: AWT1, GUD, NPHS4, WAGR, WIT-2, WT33
• Gene name: Wilms tumor 1
• Alternate names: Wilms tumor protein,
• Gene location: 11p13 (32435538: 32387774)     Exons: 11     NC_000011.10
• Gene summary(Entrez): This gene encodes a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system, and it is muta
• OMIM: 607102

Protein Summary

• Protein general information: P19544  
  • Name: Wilms tumor protein (WT33)
  • Length: 449  
  • Mass: 49,188
  • Tissue specificity: Expressed in the seminal plasma, endometrial fluid and follicular fluid (at protein level). Small intestine, colon, testis, prostate, heart, brain, lung, skeletal muscle, kidney and pancreas. Most abundant in the brain and heart. {ECO
• Sequence:

  MGSDVRDLNALLPAVPSLGGGGGCALPVSGAAQWAPVLDFAPPGASAYGSLGGPAPPPAPPPPPPPPPHSFIKQE
  PSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPSQASSGQARMFPNAPYLPSCLESQPAIRNQGYS
  TVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDN
  LYQMTSQLECMTWNQMNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRIHTHGVFRGIQDV
  RRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQR
  RHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLAL

• Structural information:
  • Interpro: IPR017987  IPR000976  IPR036236  IPR013087  
  • Prosite: PS00028 PS50157
  • PDB: 1LU6 1XF7 2G7T 2G7V 2G7W 2G7X 2JP9 2JPA 2PRT 3HPJ 3MYJ 4R2E 4R2P 4R2Q 4R2R 4R2S 4WUU 5KL2 5KL3 5KL4 5KL5 5KL6 5KL7 6B0O 6B0P 6B0Q 6B0R 6BLW
  • PDBsum: 1LU6 1XF7 2G7T 2G7V 2G7W 2G7X 2JP9 2JPA 2PRT 3HPJ 3MYJ 4R2E 4R2P 4R2Q 4R2R 4R2S 4WUU 5KL2 5KL3 5KL4 5KL5 5KL6 5KL7 6B0O 6B0P 6B0Q 6B0R 6BLW
  • STRING: ENSP00000331327
• Other Databases: GeneCards:  WT1  Malacards:  WT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding	ISS	molecular function
GO:0001570	vasculogenesis	ISS	biological process
GO:0001657	ureteric bud development	ISS	biological process
GO:0001658	branching involved in ureteric bud morphogenesis	IGI	biological process
GO:0001822	kidney development	IGI	biological process
GO:0003156	regulation of animal organ formation	ISS	biological process
GO:0003700	transcription factor activity, sequence-specific DNA binding	ISS	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	NAS	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	NAS	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0006355	regulation of transcription, DNA-templated	ISS	biological process
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:0006357	regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0006366	transcription from RNA polymerase II promoter	IEA	biological process
GO:0007281	germ cell development	ISS	biological process
GO:0007356	thorax and anterior abdomen determination	ISS	biological process
GO:0007507	heart development	IGI	biological process
GO:0007530	sex determination	IDA	biological process
GO:0008270	zinc ion binding	IDA	molecular function
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0008380	RNA splicing	ISS	biological process
GO:0008406	gonad development	ISS	biological process
GO:0008584	male gonad development	IEP	biological process
GO:0009888	tissue development	ISS	biological process
GO:0016607	nuclear speck	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0017148	negative regulation of translation	IDA	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0030325	adrenal gland development	IGI	biological process
GO:0030539	male genitalia development	ISS	biological process
GO:0030855	epithelial cell differentiation	ISS	biological process
GO:0032835	glomerulus development	IGI	biological process
GO:0032836	glomerular basement membrane development	IMP	biological process
GO:0035802	adrenal cortex formation	ISS	biological process
GO:0043010	camera-type eye development	ISS	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IGI	biological process
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IGI	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0060231	mesenchymal to epithelial transition	ISS	biological process
GO:0060421	positive regulation of heart growth	ISS	biological process
GO:0060539	diaphragm development	ISS	biological process
GO:0060923	cardiac muscle cell fate commitment	ISS	biological process
GO:0061032	visceral serous pericardium development	IGI	biological process
GO:0070742	C2H2 zinc finger domain binding	IPI	molecular function
GO:0071320	cellular response to cAMP	IEP	biological process
GO:0071371	cellular response to gonadotropin stimulus	IDA	biological process
GO:0072075	metanephric mesenchyme development	ISS	biological process
GO:0072112	glomerular visceral epithelial cell differentiation	ISS	biological process
GO:0072166	posterior mesonephric tubule development	ISS	biological process
GO:0072207	metanephric epithelium development	IEP	biological process
GO:0072284	metanephric S-shaped body morphogenesis	IGI	biological process
GO:0072302	negative regulation of metanephric glomerular mesangial cell proliferation	ISS	biological process
GO:2000020	positive regulation of male gonad development	ISS	biological process
GO:2000195	negative regulation of female gonad development	ISS	biological process
GO:2001076	positive regulation of metanephric ureteric bud development	ISS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding	ISS	molecular function
GO:0001570	vasculogenesis	ISS	biological process
GO:0001657	ureteric bud development	ISS	biological process
GO:0001658	branching involved in ureteric bud morphogenesis	IGI	biological process
GO:0001822	kidney development	IGI	biological process
GO:0003156	regulation of animal organ formation	ISS	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	ISS	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	NAS	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	NAS	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	ISS	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:0006357	regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0006366	transcription from RNA polymerase II promoter	IEA	biological process
GO:0007281	germ cell development	ISS	biological process
GO:0007356	thorax and anterior abdomen determination	ISS	biological process
GO:0007507	heart development	IGI	biological process
GO:0007530	sex determination	IDA	biological process
GO:0008270	zinc ion binding	IDA	molecular function
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0008380	RNA splicing	ISS	biological process
GO:0008406	gonad development	ISS	biological process
GO:0008584	male gonad development	IEP	biological process
GO:0009888	tissue development	ISS	biological process
GO:0016607	nuclear speck	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0017148	negative regulation of translation	IDA	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0030325	adrenal gland development	IGI	biological process
GO:0030539	male genitalia development	ISS	biological process
GO:0030855	epithelial cell differentiation	ISS	biological process
GO:0032835	glomerulus development	IGI	biological process
GO:0032836	glomerular basement membrane development	IMP	biological process
GO:0035802	adrenal cortex formation	ISS	biological process
GO:0043010	camera-type eye development	ISS	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IGI	biological process
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IGI	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0060231	mesenchymal to epithelial transition	ISS	biological process
GO:0060421	positive regulation of heart growth	ISS	biological process
GO:0060539	diaphragm development	ISS	biological process
GO:0060923	cardiac muscle cell fate commitment	ISS	biological process
GO:0061032	visceral serous pericardium development	IGI	biological process
GO:0070742	C2H2 zinc finger domain binding	IPI	molecular function
GO:0071320	cellular response to cAMP	IEP	biological process
GO:0071371	cellular response to gonadotropin stimulus	IDA	biological process
GO:0072075	metanephric mesenchyme development	ISS	biological process
GO:0072112	glomerular visceral epithelial cell differentiation	ISS	biological process
GO:0072166	posterior mesonephric tubule development	ISS	biological process
GO:0072207	metanephric epithelium development	IEP	biological process
GO:0072284	metanephric S-shaped body morphogenesis	IGI	biological process
GO:0072302	negative regulation of metanephric glomerular mesangial cell proliferation	ISS	biological process
GO:2000020	positive regulation of male gonad development	ISS	biological process
GO:2000195	negative regulation of female gonad development	ISS	biological process
GO:2001076	positive regulation of metanephric ureteric bud development	ISS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding	ISS	molecular function
GO:0001570	vasculogenesis	ISS	biological process
GO:0001657	ureteric bud development	ISS	biological process
GO:0001658	branching involved in ureteric bud morphogenesis	IGI	biological process
GO:0001822	kidney development	IGI	biological process
GO:0003156	regulation of animal organ formation	ISS	biological process
GO:0003700	transcription factor activity, sequence-specific DNA binding	ISS	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	NAS	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0006355	regulation of transcription, DNA-templated	ISS	biological process
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:0006357	regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0007281	germ cell development	ISS	biological process
GO:0007356	thorax and anterior abdomen determination	ISS	biological process
GO:0007507	heart development	IGI	biological process
GO:0007530	sex determination	IDA	biological process
GO:0008270	zinc ion binding	IDA	molecular function
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0008380	RNA splicing	ISS	biological process
GO:0008406	gonad development	ISS	biological process
GO:0008584	male gonad development	IEP	biological process
GO:0009888	tissue development	ISS	biological process
GO:0016607	nuclear speck	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0017148	negative regulation of translation	IDA	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0030325	adrenal gland development	IGI	biological process
GO:0030539	male genitalia development	ISS	biological process
GO:0030855	epithelial cell differentiation	ISS	biological process
GO:0032835	glomerulus development	IGI	biological process
GO:0032836	glomerular basement membrane development	IMP	biological process
GO:0035802	adrenal cortex formation	ISS	biological process
GO:0043010	camera-type eye development	ISS	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IGI	biological process
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IGI	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0060231	mesenchymal to epithelial transition	ISS	biological process
GO:0060421	positive regulation of heart growth	ISS	biological process
GO:0060539	diaphragm development	ISS	biological process
GO:0060923	cardiac muscle cell fate commitment	ISS	biological process
GO:0061032	visceral serous pericardium development	IGI	biological process
GO:0070742	C2H2 zinc finger domain binding	IPI	molecular function
GO:0071320	cellular response to cAMP	IEP	biological process
GO:0071371	cellular response to gonadotropin stimulus	IDA	biological process
GO:0072075	metanephric mesenchyme development	ISS	biological process
GO:0072112	glomerular visceral epithelial cell differentiation	ISS	biological process
GO:0072166	posterior mesonephric tubule development	ISS	biological process
GO:0072207	metanephric epithelium development	IEP	biological process
GO:0072284	metanephric S-shaped body morphogenesis	IGI	biological process
GO:0072302	negative regulation of metanephric glomerular mesangial cell proliferation	ISS	biological process
GO:2000020	positive regulation of male gonad development	ISS	biological process
GO:2000195	negative regulation of female gonad development	ISS	biological process
GO:2001076	positive regulation of metanephric ureteric bud development	ISS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05202	Transcriptional misregulation in cancer

Diseases

Associated diseases	References
Cancer	GAD: 11518820
Cancer (kidney)	GAD: 18618575
Cancer (leukemia)	GAD: 20959405
Cancer (myeloid leukemia)	GAD: 20038731
Cancer (pancreatic)	GAD: 19351817
Cancer (thyroid)	GAD: 19730683
Mesothelioma	OMIM: 607102
Cancer (endometrial)	INFBASE: 15297187
WAGR syndrome	GAD: 7687865
Wilms tumor	MIK: 19048299
Wilms tumor	OMIM: 607102
Denys-Drash syndrome	OMIM: 607102
Frasier syndrome	OMIM: 607102
Abnormal urogenital development	GAD: 1655284
Eye diseases	GAD: 18058136
Alzheimer's disease	GAD: 12914969
Chronic renal failure	GAD: 20507940
Premature ovarian failure (POF)	INFBASE: 26358501
Polycystic ovary syndrome (PCOS)	INFBASE: 22238403
XY gonadal dysgenesis	INFBASE: 7607640
46,XY Disorders of sex development	MIK: 21508141
Hypospadias	MIK: 21508141
Cryptorchidism	MIK: 21508141
Ambiguous genitalia	MIK: 12050205
Absence of gonadal dysgenesis	MIK: 12050205
Bilateral cryptorchidism	MIK: 19048299
Macrosomia	MIK: 22801570
Hypospadias	MIK: 10092153
Hypergonadotropic hypogonadism	MIK: 16476716
Male factor infertility	MIK: 25451826
Non obstructive azoospermia	MIK: 23935527
Complete androgen insensitivity syndrome (CAIS)	MIK: 10092153
Ambiguous genitalia	INFBASE: 22801570
Congenital absence of the uterus and vagina (CAUV)	MIK: 9757958
Azoospermia	MIK: 24912414
Deep infiltrating endometriosis	INFBASE: 18722603
Endometriosis	INFBASE: 24018808
Meacham syndrome	OMIM: 607102
Focal segmental glomerulosclerosis	KEGG: H00626
Nephrotic syndrome	KEGG: H01657
46,XY Disorders in sex development	MIK: 21508141
Hypospadias	MIK: 21508141
Cryptorchidism	MIK: 21508141
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Ambiguous genitalia	MIK: 15191353
Absence of gonadal dysgenesis	MIK: 12050205
Bilateral cryptorchidism	MIK: 19048299
Wilms tumor	MIK: 19048299
Could be involved in the regulation by Sertoli cells of germ cell maturation	MIK: 8950512
Azoospermia	MIK: 24912414
Hypergonadotropic hypogonadism	MIK: 16476716
Hypospadias	MIK: 10092153
Complete androgen insensitivity syndrome (CAIS)	MIK: 10092153
Idiopathic nonobstructive azoospermia (INOA)	MIK: 27990711
Macrosomia	MIK: 22801570
Ambiguous genitalia	MIK: 22801570
Male infertility	MIK: 25451826
Non-obstructive azoospermia(NOA)	MIK: 23935527
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
15191353	Ambiguous genitalia	WT1 mutation (P181S)		1 ambiguous genitalia	Male infertiltiy
10092153	Hypospadias, CAIS			35 boys with hypopadias, 1 girl CAIS	Male infertility	AR WT1 5alpha-reductase
25451826	Male infertility,	p.Pro130Leu, pCys350Arg	Portugu ese	414 (194 patients with nonobstructive azoospermia, 188 with severe oligozoospermia, 31 infertile males, 1 patient with anorchia)	Male infertility
24912414	Cryptorchidism, azoospermia.		Portugu ese	32 patients with isolated uni- or bilateral cryptorchidism	Male infertility
21508141	46,XY DSD, severe hypospadias, cryptorchidism			210 (150 males with severe hypospadias (70 without cryptorchidism, 80 with at least one cryptorchid testis), 10 males with vanishing testes syndrome, and 50 raised females with partial to complete 46,XY gonadal dysgenesis)	Male infertility
19048299	Bilateral cryptorchidism, Wilms tumor	WT1 nonsense mutation (c.1105C>T), introducing a premature stop codon in exon 8 (p.Q369X)			Male infertility
16476716	Hypergonadotropic hypogonadism				Male infertility
12050205	Ambiguous genitalia, absence of gonadal dysgenesis	IVS9 +4C>T		1	Male infertility
10092153	Hypospadias			36 (35 boys with hypopadias, 1 girl diagnosed as with CAIS)	Male infertility
22801570	Macrosomia, ambiguous genitalia			1 case of macrosomia and genital ambiguity	Male infertility
23935527	Non-obstructive azoospermia(NOA)			529 human patients with non-obstructive azoospermia(NOA), indicating a strong association between WT1 mutation and NOA	Male infertility
8950512	Could be involved in the regulation by Sertoli cells of germ cell maturation				Male infertility
27990711	Idiopathic nonobstructive azoospermia (INOA), Male infertility	p.Phe435Leu (p.F435L)		400 (200 patients diagnosed with INOA, 200 proven-fertile men)	Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray