• Gene id: 7484

Gene Summary

• Gene Symbol: WNT9B   Gene   UCSC   Ensembl
• Aliases: WNT14B, WNT15
• Gene name: Wnt family member 9B
• Alternate names: protein Wnt-9b, protein Wnt-14b, wingless-type MMTV integration site family member 9B, wingless-type MMTV integration site family, member 15,
• Gene location: 17q21.32 (56557124: 56621836)     Exons: 23     NC_000003.12
• Gene summary(Entrez): The WNT gene family consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryoge
• OMIM: 602864

Protein Summary

• Protein general information: O14905  
  • Name: Protein Wnt 9b (Protein Wnt 14b) (Protein Wnt 15)
  • Length: 357  
  • Mass: 39001
  • Tissue specificity: Moderately expressed in fetal kidney and adult kidney. Also found in brain.
• Sequence:

  MRPPPALALAGLCLLALPAAAASYFGLTGREVLTPFPGLGTAAAPAQGGAHLKQCDLLKLSRRQKQLCRREPGLA
  ETLRDAAHLGLLECQFQFRHERWNCSLEGRMGLLKRGFKETAFLYAVSSAALTHTLARACSAGRMERCTCDDSPG
  LESRQAWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCW
  KQLSPFRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGDLVYMEDSPSFCRPSKYSPGT
  AGRVCSREASCSSLCCGRGYDTQSRLVAFSCHCQVQWCCYVECQQCVQEELVYTCKH

• Structural information:
  • Interpro: IPR005817  IPR026535  IPR018161  
  • Prosite: PS00246
  • STRING: ENSP00000290015
• Other Databases: GeneCards:  WNT9B  Malacards:  WNT9B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1905438	non-canonical Wnt signaling pathway involved in midbrain dopaminergic neuron differentiation	IDA	biological process
GO:1902455	negative regulation of stem cell population maintenance	IMP	biological process
GO:1904948	midbrain dopaminergic neuron differentiation	IMP	biological process
GO:0005125	cytokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0045165	cell fate commitment	IBA	biological process
GO:0005109	frizzled binding	IBA	molecular function
GO:0030182	neuron differentiation	IBA	biological process
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0016055	Wnt signaling pathway	TAS	biological process
GO:0048018	receptor ligand activity	IDA	molecular function
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0072181	mesonephric duct formation	IEA	biological process
GO:0072170	metanephric tubule development	IEA	biological process
GO:0072038	mesenchymal stem cell maintenance involved in nephron morphogenesis	IEA	biological process
GO:0072003	kidney rudiment formation	IEA	biological process
GO:0048754	branching morphogenesis of an epithelial tube	IEA	biological process
GO:0048701	embryonic cranial skeleton morphogenesis	IEA	biological process
GO:0035150	regulation of tube size	IEA	biological process
GO:0030539	male genitalia development	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0009786	regulation of asymmetric cell division	IEA	biological process
GO:0001822	kidney development	IEA	biological process
GO:0072174	metanephric tubule formation	IEA	biological process
GO:0072164	mesonephric tubule development	IEA	biological process
GO:0072078	nephron tubule morphogenesis	IEA	biological process
GO:0072046	establishment of planar polarity involved in nephron morphogenesis	IEA	biological process
GO:0072044	collecting duct development	IEA	biological process
GO:0061038	uterus morphogenesis	IEA	biological process
GO:0060993	kidney morphogenesis	IEA	biological process
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	IEA	biological process
GO:0060070	canonical Wnt signaling pathway	IEA	biological process
GO:0060021	roof of mouth development	IEA	biological process
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0039706	co-receptor binding	IEA	molecular function
GO:0009267	cellular response to starvation	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0003339	regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis	IEA	biological process
GO:0001932	regulation of protein phosphorylation	IEA	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0001658	branching involved in ureteric bud morphogenesis	IEA	biological process
GO:0032526	response to retinoic acid	NAS	biological process
GO:0061303	cornea development in camera-type eye	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0071300	cellular response to retinoic acid	ISS	biological process
GO:0030182	neuron differentiation	ISS	biological process
GO:0005576	extracellular region	NAS	cellular component
GO:0007275	multicellular organism development	NAS	biological process
GO:0007267	cell-cell signaling	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa05165	Human papillomavirus infection
hsa05205	Proteoglycans in cancer
hsa04310	Wnt signaling pathway
hsa04150	mTOR signaling pathway
hsa04390	Hippo signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa04916	Melanogenesis
hsa05217	Basal cell carcinoma

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)