• Gene id: 7483

Gene Summary

• Gene Symbol: WNT9A   Gene   UCSC   Ensembl
• Aliases: WNT14
• Gene name: Wnt family member 9A
• Alternate names: protein Wnt-9a, wingless-type MMTV integration site family, member 14, wingless-type MMTV integration site family, member 9A,
• Gene location: 1q42.13 (227947931: 227918655)     Exons: 5     NC_000001.11
• Gene summary(Entrez): The WNT gene family consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryoge

Protein Summary

• Protein general information: O14904  
  • Name: Protein Wnt 9a (Protein Wnt 14)
  • Length: 365  
  • Mass: 40320
• Sequence:

  MLDGSPLARWLAAAFGLTLLLAALRPSAAYFGLTGSEPLTILPLTLEPEAAAQAHYKACDRLKLERKQRRMCRRD
  PGVAETLVEAVSMSALECQFQFRFERWNCTLEGRYRASLLKRGFKETAFLYAISSAGLTHALAKACSAGRMERCT
  CDEAPDLENREAWQWGGCGDNLKYSSKFVKEFLGRRSSKDLRARVDFHNNLVGVKVIKAGVETTCKCHGVSGSCT
  VRTCWRQLAPFHEVGKHLKHKYETALKVGSTTNEAAGEAGAISPPRGRASGAGGSDPLPRTPELVHLDDSPSFCL
  AGRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEVYTCKG

• Structural information:
  • Interpro: IPR005817  IPR013303  IPR018161  
  • Prosite: PS00246
  • STRING: ENSP00000272164
• Other Databases: GeneCards:  WNT9A  Malacards:  WNT9A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005109	frizzled binding	IBA	molecular function
GO:0030182	neuron differentiation	IBA	biological process
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0005125	cytokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0045165	cell fate commitment	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0016055	Wnt signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0048018	receptor ligand activity	IDA	molecular function
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0060548	negative regulation of cell death	IEA	biological process
GO:0045597	positive regulation of cell differentiation	IEA	biological process
GO:0061037	negative regulation of cartilage development	IEA	biological process
GO:0060070	canonical Wnt signaling pathway	IEA	biological process
GO:0048856	anatomical structure development	IEA	biological process
GO:0048704	embryonic skeletal system morphogenesis	IEA	biological process
GO:0045880	positive regulation of smoothened signaling pathway	IEA	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0035115	embryonic forelimb morphogenesis	IEA	biological process
GO:0032331	negative regulation of chondrocyte differentiation	IEA	biological process
GO:0007093	mitotic cell cycle checkpoint	IMP	biological process
GO:0008285	negative regulation of cell population proliferation	IMP	biological process
GO:0061072	iris morphogenesis	ISS	biological process
GO:0072498	embryonic skeletal joint development	ISS	biological process
GO:0032331	negative regulation of chondrocyte differentiation	ISS	biological process
GO:0061303	cornea development in camera-type eye	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030182	neuron differentiation	ISS	biological process
GO:0007267	cell-cell signaling	NAS	biological process
GO:0071300	cellular response to retinoic acid	ISS	biological process
GO:0007275	multicellular organism development	NAS	biological process
GO:0005576	extracellular region	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa05165	Human papillomavirus infection
hsa05205	Proteoglycans in cancer
hsa04310	Wnt signaling pathway
hsa04150	mTOR signaling pathway
hsa04390	Hippo signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa04916	Melanogenesis
hsa05217	Basal cell carcinoma

Diseases

Associated diseases	References
Breast cancer	PMID:11713592
pancreatic cancer	PMID:18772397
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq