• Gene id: 7482

Gene Summary

• Gene Symbol: WNT2B   Gene   UCSC   Ensembl
• Aliases: WNT13
• Gene name: Wnt family member 2B
• Alternate names: protein Wnt-2b, XWNT2, Xenopus, homolog of, wingless-type MMTV integration site family, member 13, wingless-type MMTV integration site family, member 2B,
• Gene location: 1p13.2 (112466540: 112530164)     Exons: 7     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the wingless-type MMTV integration site (WNT) family of highly conserved, secreted signaling factors. WNT family members function in a variety of developmental processes including regulation of cell growth and differentiation
• OMIM: 601968

Protein Summary

• Protein general information: Q93097  
  • Name: Protein Wnt 2b (Protein Wnt 13)
  • Length: 391  
  • Mass: 43770
  • Tissue specificity: Isoform 1 is expressed in adult heart, brain, placenta, lung, prostate, testis, ovary, small intestine and colon. In the adult brain, it is mainly found in the caudate nucleus, subthalamic nucleus and thalamus. Also detected in fetal b
• Sequence:

  MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLLTLPARVDTSWWYIGALGARVICDNI
  PGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLDRDHTVFGRVMLRSSREAAFVYAISSAGV
  VHAITRACSQGELSVCSCDPYTRGRHHDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCG
  RTAVRRFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLV
  YFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTVD
  VHTCKAPKKAEWLDQT

• Structural information:
  • Interpro: IPR005817  IPR009140  IPR018161  
  • Prosite: PS00246
  • STRING: ENSP00000358698
• Other Databases: GeneCards:  WNT2B  Malacards:  WNT2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0030182	neuron differentiation	IBA	biological process
GO:0005109	frizzled binding	IBA	molecular function
GO:0045165	cell fate commitment	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005125	cytokine activity	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0016055	Wnt signaling pathway	TAS	biological process
GO:0021871	forebrain regionalization	IEA	biological process
GO:0090190	positive regulation of branching involved in ureteric bud morphogenesis	IEA	biological process
GO:0060638	mesenchymal-epithelial cell signaling	IEA	biological process
GO:0060492	lung induction	IEA	biological process
GO:0060070	canonical Wnt signaling pathway	IEA	biological process
GO:0009267	cellular response to starvation	IEA	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0071425	hematopoietic stem cell proliferation	IDA	biological process
GO:0002088	lens development in camera-type eye	ISS	biological process
GO:0061072	iris morphogenesis	ISS	biological process
GO:0061303	cornea development in camera-type eye	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0030182	neuron differentiation	ISS	biological process
GO:0060070	canonical Wnt signaling pathway	IMP	biological process
GO:0008584	male gonad development	IEP	biological process
GO:0002062	chondrocyte differentiation	IEP	biological process
GO:0021871	forebrain regionalization	IEP	biological process
GO:0005615	extracellular space	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa05165	Human papillomavirus infection
hsa05205	Proteoglycans in cancer
hsa04310	Wnt signaling pathway
hsa04150	mTOR signaling pathway
hsa04390	Hippo signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa04916	Melanogenesis
hsa05217	Basal cell carcinoma

Diseases

Associated diseases	References
Endodermal sinus tumor	PMID:16822086
Teratoma	PMID:16822086
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R