• Gene id: 7481

Gene Summary

• Gene Symbol: WNT11   Gene   UCSC   Ensembl
• Aliases: HWNT11
• Gene name: Wnt family member 11
• Alternate names: protein Wnt-11, wingless-type MMTV integration site family, member 11,
• Gene location: 11q13.5 (76210841: 76186324)     Exons: 8     NC_000011.10
• Gene summary(Entrez): The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog
• OMIM: 608053

Protein Summary

• Protein general information: O96014  
  • Name: Protein Wnt 11
  • Length: 354  
  • Mass: 39179
  • Tissue specificity: Expressed in fetal lung, kidney, adult heart, liver, skeletal muscle, and pancreas. {ECO
• Sequence:

  MRARPQVCEALLFALALQTGVCYGIKWLALSKTPSALALNQTQHCKQLEGLVSAQVQLCRSNLELMHTVVHAARE
  VMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAAAISHAIARACTSGDLPGCSCGPVPGEPPGP
  GNRWGGCADNLSYGLLMGAKFSDAPMKVKKTGSQANKLMRLHNSEVGRQALRASLEMKCKCHGVSGSCSIRTCWK
  GLQELQDVAADLKTRYLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCN
  KTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK

• Structural information:
  • Interpro: IPR005817  IPR026536  IPR018161  
  • Prosite: PS00246
  • STRING: ENSP00000325526
• Other Databases: GeneCards:  WNT11  Malacards:  WNT11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005109	frizzled binding	NAS	molecular function
GO:0007223	Wnt signaling pathway, calcium modulating pathway	NAS	biological process
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	NAS	biological process
GO:0045165	cell fate commitment	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005125	cytokine activity	IBA	molecular function
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0030182	neuron differentiation	IBA	biological process
GO:0005109	frizzled binding	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0016055	Wnt signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0001649	osteoblast differentiation	IEA	biological process
GO:0001822	kidney development	IEA	biological process
GO:0003139	secondary heart field specification	IEA	biological process
GO:0003283	atrial septum development	IEA	biological process
GO:0003402	planar cell polarity pathway involved in axis elongation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0031012	extracellular matrix	IEA	cellular component
GO:0032915	positive regulation of transforming growth factor beta2 production	IEA	biological process
GO:0035567	non-canonical Wnt signaling pathway	IEA	biological process
GO:0048341	paraxial mesoderm formation	IEA	biological process
GO:0048570	notochord morphogenesis	IEA	biological process
GO:0061053	somite development	IEA	biological process
GO:0090272	negative regulation of fibroblast growth factor production	IEA	biological process
GO:0031667	response to nutrient levels	IEA	biological process
GO:0001837	epithelial to mesenchymal transition	IEA	biological process
GO:0003138	primary heart field specification	IEA	biological process
GO:0003151	outflow tract morphogenesis	IEA	biological process
GO:0003281	ventricular septum development	IEA	biological process
GO:0030282	bone mineralization	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0045199	maintenance of epithelial cell apical/basal polarity	IEA	biological process
GO:0048844	artery morphogenesis	IEA	biological process
GO:0060021	roof of mouth development	IEA	biological process
GO:0060028	convergent extension involved in axis elongation	IEA	biological process
GO:0060070	canonical Wnt signaling pathway	IEA	biological process
GO:0060412	ventricular septum morphogenesis	IEA	biological process
GO:0060775	planar cell polarity pathway involved in gastrula mediolateral intercalation	IEA	biological process
GO:0070830	bicellular tight junction assembly	IEA	biological process
GO:0071260	cellular response to mechanical stimulus	IEA	biological process
GO:0072201	negative regulation of mesenchymal cell proliferation	IEA	biological process
GO:0090082	positive regulation of heart induction by negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0062009	secondary palate development	IMP	biological process
GO:0032147	activation of protein kinase activity	IEA	biological process
GO:0032147	activation of protein kinase activity	IEA	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0030308	negative regulation of cell growth	IMP	biological process
GO:0030295	protein kinase activator activity	IMP	molecular function
GO:0090090	negative regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0072177	mesonephric duct development	IEP	biological process
GO:0071300	cellular response to retinoic acid	ISS	biological process
GO:0061101	neuroendocrine cell differentiation	IMP	biological process
GO:0061037	negative regulation of cartilage development	NAS	biological process
GO:0060197	cloacal septation	IEP	biological process
GO:0030182	neuron differentiation	ISS	biological process
GO:0006468	protein phosphorylation	IMP	biological process
GO:0005096	GTPase activator activity	IMP	molecular function
GO:0090037	positive regulation of protein kinase C signaling	IMP	biological process
GO:0060548	negative regulation of cell death	IMP	biological process
GO:0060484	lung-associated mesenchyme development	IEP	biological process
GO:0051496	positive regulation of stress fiber assembly	IMP	biological process
GO:0048706	embryonic skeletal system development	IEP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0030336	negative regulation of cell migration	IMP	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0030325	adrenal gland development	IEP	biological process
GO:0030295	protein kinase activator activity	IMP	molecular function
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0060675	ureteric bud morphogenesis	IEP	biological process
GO:0034394	protein localization to cell surface	IMP	biological process
GO:0043547	positive regulation of GTPase activity	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa05165	Human papillomavirus infection
hsa05205	Proteoglycans in cancer
hsa04310	Wnt signaling pathway
hsa04150	mTOR signaling pathway
hsa04390	Hippo signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa04916	Melanogenesis
hsa05217	Basal cell carcinoma

Diseases

Associated diseases	References
renal cell carcinoma	PMID:11712081
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq