• Gene id: 7480

Gene Summary

• Gene Symbol: WNT10B   Gene   UCSC   Ensembl
• Aliases: SHFM6, STHAG8, WNT-12
• Gene name: Wnt family member 10B
• Alternate names: protein Wnt-10b, WNT-10B protein, wingless-type MMTV integration site family, member 10B,
• Gene location: 12q13.12 (48979586: 48965339)     Exons: 8     NC_000012.12
• Gene summary(Entrez): The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog
• OMIM: 616020

Protein Summary

• Protein general information: O00744  
  • Name: Protein Wnt 10b (Protein Wnt 12)
  • Length: 389  
  • Mass: 43000
  • Tissue specificity: Detected in most adult tissues. Highest levels were found in heart and skeletal muscle. Low levels are found in brain.
• Sequence:

  MLEEPRPRPPPSGLAGLLFLALCSRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLGLCLRNPDVTASALQG
  LHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFSFSMLAAGVMHAVATACSLGKLVSCGCGWKG
  SGEQDRLRAKLLQLQALSRGKSFPHSLPSPGPGSSPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQA
  RMRIHNNRVGRQVVTENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR
  PRRLSGELVYFEKSPDFCERDPTMGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTRVERCHCRFHWCCYVL
  CDECKVTEWVNVCK

• Structural information:
  • Interpro: IPR005817  IPR013302  IPR018161  
  • Prosite: PS00246
  • STRING: ENSP00000301061
• Other Databases: GeneCards:  WNT10B  Malacards:  WNT10B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005109	frizzled binding	IBA	molecular function
GO:0030182	neuron differentiation	IBA	biological process
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0005125	cytokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0045165	cell fate commitment	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0016055	Wnt signaling pathway	TAS	biological process
GO:0071425	hematopoietic stem cell proliferation	IEA	biological process
GO:0071320	cellular response to cAMP	IEA	biological process
GO:0071310	cellular response to organic substance	IEA	biological process
GO:0061196	fungiform papilla development	IEA	biological process
GO:0060346	bone trabecula formation	IEA	biological process
GO:0050909	sensory perception of taste	IEA	biological process
GO:0050680	negative regulation of epithelial cell proliferation	IEA	biological process
GO:0048741	skeletal muscle fiber development	IEA	biological process
GO:0048641	regulation of skeletal muscle tissue development	IEA	biological process
GO:0045899	positive regulation of RNA polymerase II transcription preinitiation complex assembly	IEA	biological process
GO:0045778	positive regulation of ossification	IEA	biological process
GO:0045669	positive regulation of osteoblast differentiation	IEA	biological process
GO:0045599	negative regulation of fat cell differentiation	IEA	biological process
GO:0043403	skeletal muscle tissue regeneration	IEA	biological process
GO:0030501	positive regulation of bone mineralization	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0010971	positive regulation of G2/M transition of mitotic cell cycle	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0007050	cell cycle arrest	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0000086	G2/M transition of mitotic cell cycle	IEA	biological process
GO:0120163	negative regulation of cold-induced thermogenesis	IEA	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:0071374	cellular response to parathyroid hormone stimulus	IEA	biological process
GO:0060070	canonical Wnt signaling pathway	IEA	biological process
GO:0051885	positive regulation of timing of anagen	IEA	biological process
GO:0051246	regulation of protein metabolic process	IEA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0045598	regulation of fat cell differentiation	IEA	biological process
GO:0032434	regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0030858	positive regulation of epithelial cell differentiation	IEA	biological process
GO:0014835	myoblast differentiation involved in skeletal muscle regeneration	IEA	biological process
GO:0007224	smoothened signaling pathway	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0048018	receptor ligand activity	IC	molecular function
GO:0045599	negative regulation of fat cell differentiation	IDA	biological process
GO:0050821	protein stabilization	IDA	biological process
GO:0071425	hematopoietic stem cell proliferation	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0120163	negative regulation of cold-induced thermogenesis	ISS	biological process
GO:0071300	cellular response to retinoic acid	ISS	biological process
GO:0005615	extracellular space	NAS	cellular component
GO:0030182	neuron differentiation	ISS	biological process
GO:0002062	chondrocyte differentiation	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa05165	Human papillomavirus infection
hsa05205	Proteoglycans in cancer
hsa04310	Wnt signaling pathway
hsa04150	mTOR signaling pathway
hsa04390	Hippo signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa04916	Melanogenesis
hsa05217	Basal cell carcinoma

Diseases

Associated diseases	References
Tooth agenesis	KEGG:H00625
Split-hand/foot malformation	KEGG:H00471
Tooth agenesis	KEGG:H00625
Split-hand/foot malformation	KEGG:H00471
obesity	PMID:16477437
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq