• Gene id: 7479

Gene Summary

• Gene Symbol: WNT8B   Gene   UCSC   Ensembl
• Gene name: Wnt family member 8B
• Alternate names: protein Wnt-8b, epididymis secretory sperm binding protein, wingless-type MMTV integration site family, member 8B,
• Gene location: 10q24.31 (100463008: 100483743)     Exons: 6     NC_000010.11
• Gene summary(Entrez): The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog
• OMIM: 601396

Protein Summary

• Protein general information: Q93098  
  • Name: Protein Wnt 8b
  • Length: 351  
  • Mass: 38721
  • Tissue specificity: Expression is restricted to the brain, and more specifically to the forebrain. {ECO
• Sequence:

  MFLSKPSVYICLFTCVLQLSHSWSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSH
  GGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDAL
  ETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAG
  NSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEE
  RRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPRGGAAHKPGRKP

• Structural information:
  • Interpro: IPR034311  IPR005817  IPR013301  IPR018161  
  • Prosite: PS00246
  • STRING: ENSP00000340677
• Other Databases: GeneCards:  WNT8B  Malacards:  WNT8B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005109	frizzled binding	IBA	molecular function
GO:0030182	neuron differentiation	IBA	biological process
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0005125	cytokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0045165	cell fate commitment	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007399	nervous system development	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0016055	Wnt signaling pathway	TAS	biological process
GO:1904886	beta-catenin destruction complex disassembly	TAS	biological process
GO:0048018	receptor ligand activity	IDA	molecular function
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0032355	response to estradiol	NAS	biological process
GO:0007369	gastrulation	ISS	biological process
GO:0032526	response to retinoic acid	NAS	biological process
GO:0048263	determination of dorsal identity	ISS	biological process
GO:0030182	neuron differentiation	ISS	biological process
GO:0071300	cellular response to retinoic acid	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa05165	Human papillomavirus infection
hsa05205	Proteoglycans in cancer
hsa04310	Wnt signaling pathway
hsa04150	mTOR signaling pathway
hsa04390	Hippo signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa04916	Melanogenesis
hsa05217	Basal cell carcinoma

Diseases

Associated diseases	References
Hirschsprung's disease	PMID:20972907
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray