• Gene id: 7477

Gene Summary

• Gene Symbol: WNT7B   Gene   UCSC   Ensembl
• Gene name: Wnt family member 7B
• Alternate names: protein Wnt-7b, wingless-type MMTV integration site family, member 7B,
• Gene location: 22q13.31 (45977161: 45920361)     Exons: 5     NC_000022.11
• Gene summary(Entrez): This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fat
• OMIM: 601967

Protein Summary

• Protein general information: P56706  
  • Name: Protein Wnt 7b
  • Length: 349  
  • Mass: 39327
  • Tissue specificity: Moderately expressed in fetal brain, weakly expressed in fetal lung and kidney, and faintly expressed in adult brain, lung and prostate.
• Sequence:

  MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQY
  QFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWG
  GCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVG
  HLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPG
  ADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK

• Structural information:
  • Interpro: IPR005817  IPR013300  IPR018161  
  • Prosite: PS00246
  • STRING: ENSP00000341032
• Other Databases: GeneCards:  WNT7B  Malacards:  WNT7B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005109	frizzled binding	IBA	molecular function
GO:0030182	neuron differentiation	IBA	biological process
GO:0046330	positive regulation of JNK cascade	IBA	biological process
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0005125	cytokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0045165	cell fate commitment	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0016055	Wnt signaling pathway	TAS	biological process
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0070062	extracellular exosome	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0048018	receptor ligand activity	IDA	molecular function
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0048812	neuron projection morphogenesis	IEA	biological process
GO:0046330	positive regulation of JNK cascade	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0032536	regulation of cell projection size	IEA	biological process
GO:0031175	neuron projection development	IEA	biological process
GO:0007257	activation of JUN kinase activity	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0070307	lens fiber cell development	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0072205	metanephric collecting duct development	ISS	biological process
GO:0072089	stem cell proliferation	IEP	biological process
GO:0072060	outer medullary collecting duct development	ISS	biological process
GO:0072054	renal outer medulla development	ISS	biological process
GO:0072053	renal inner medulla development	ISS	biological process
GO:0060560	developmental growth involved in morphogenesis	ISS	biological process
GO:0060482	lobar bronchus development	ISS	biological process
GO:0050808	synapse organization	ISS	biological process
GO:0042592	homeostatic process	ISS	biological process
GO:0021871	forebrain regionalization	IEP	biological process
GO:0072061	inner medullary collecting duct development	ISS	biological process
GO:0071300	cellular response to retinoic acid	IEP	biological process
GO:0060669	embryonic placenta morphogenesis	ISS	biological process
GO:0060428	lung epithelium development	ISS	biological process
GO:0060070	canonical Wnt signaling pathway	ISS	biological process
GO:0032364	oxygen homeostasis	ISS	biological process
GO:0030324	lung development	ISS	biological process
GO:0030182	neuron differentiation	IEP	biological process
GO:0001701	in utero embryonic development	ISS	biological process
GO:0072236	metanephric loop of Henle development	ISS	biological process
GO:0072207	metanephric epithelium development	ISS	biological process
GO:0071300	cellular response to retinoic acid	IEP	biological process
GO:0060710	chorio-allantoic fusion	ISS	biological process
GO:0060535	trachea cartilage morphogenesis	ISS	biological process
GO:0060425	lung morphogenesis	ISS	biological process
GO:0048568	embryonic organ development	ISS	biological process
GO:0044237	cellular metabolic process	ISS	biological process
GO:0003338	metanephros morphogenesis	ISS	biological process
GO:0061180	mammary gland epithelium development	IEP	biological process
GO:0048144	fibroblast proliferation	IEP	biological process
GO:0045669	positive regulation of osteoblast differentiation	ISS	biological process
GO:0022009	central nervous system vasculogenesis	ISS	biological process
GO:0016332	establishment or maintenance of polarity of embryonic epithelium	ISS	biological process
GO:0016055	Wnt signaling pathway	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa05165	Human papillomavirus infection
hsa05205	Proteoglycans in cancer
hsa04310	Wnt signaling pathway
hsa04150	mTOR signaling pathway
hsa04390	Hippo signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa04916	Melanogenesis
hsa05217	Basal cell carcinoma

Diseases

Associated diseases	References
urinary bladder cancer	PMID:9461004
Breast cancer	PMID:15492823
Breast fibroadenoma	PMID:8168088
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq