• Gene id: 7476

Gene Summary

• Gene Symbol: WNT7A   Gene   UCSC   Ensembl
• Aliases: Wnt-7a
• Gene name: Wnt family member 7A
• Alternate names: protein Wnt-7a, proto-oncogene Wnt7a protein, wingless-type MMTV integration site family, member 7A,
• Gene location: 3p25.1 (13880070: 13816257)     Exons: 6     NC_000003.12
• Gene summary(Entrez): This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fat
• OMIM: 606571

Protein Summary

• Protein general information: O00755  
  • Name: Protein Wnt 7a
  • Length: 349  
  • Mass: 39005
  • Tissue specificity: Expression is restricted to placenta, kidney, testis, uterus, fetal lung, and fetal and adult brain.
• Sequence:

  MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAIIVIGEGSQMGLDECQF
  QFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAITAACTQGNLSDCGCDKEKQGQYHRDEGWKWG
  GCSADIRYGIGFAKVFVDAREIKQNARTLMNLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELG
  YVLKDKYNEAVHVEPVRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
  ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK

• Structural information:
  • Interpro: IPR005817  IPR013300  IPR018161  
  • Prosite: PS00246
  • PDB: 4UZQ
  • PDBsum: 4UZQ
  • DIP: 61511
  • STRING: ENSP00000285018
• Other Databases: GeneCards:  WNT7A  Malacards:  WNT7A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032270	positive regulation of cellular protein metabolic process	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:2000463	positive regulation of excitatory postsynaptic potential	IDA	biological process
GO:1904891	positive regulation of excitatory synapse assembly	IDA	biological process
GO:0036465	synaptic vesicle recycling	TAS	biological process
GO:0099054	presynapse assembly	TAS	biological process
GO:0099068	postsynapse assembly	TAS	biological process
GO:0007409	axonogenesis	TAS	biological process
GO:0060997	dendritic spine morphogenesis	IDA	biological process
GO:1904861	excitatory synapse assembly	TAS	biological process
GO:1905386	positive regulation of protein localization to presynapse	TAS	biological process
GO:0045165	cell fate commitment	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005125	cytokine activity	IBA	molecular function
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0046330	positive regulation of JNK cascade	IBA	biological process
GO:0030182	neuron differentiation	IBA	biological process
GO:0005109	frizzled binding	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005102	signaling receptor binding	NAS	molecular function
GO:0007548	sex differentiation	TAS	biological process
GO:0002062	chondrocyte differentiation	IDA	biological process
GO:0001502	cartilage condensation	IDA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0016055	Wnt signaling pathway	TAS	biological process
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0070062	extracellular exosome	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048018	receptor ligand activity	IDA	molecular function
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0042060	wound healing	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0007269	neurotransmitter secretion	IEA	biological process
GO:0009953	dorsal/ventral pattern formation	IEA	biological process
GO:0010595	positive regulation of endothelial cell migration	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0022009	central nervous system vasculogenesis	IEA	biological process
GO:0030010	establishment of cell polarity	IEA	biological process
GO:0030326	embryonic limb morphogenesis	IEA	biological process
GO:0031012	extracellular matrix	IEA	cellular component
GO:0031133	regulation of axon diameter	IEA	biological process
GO:0035567	non-canonical Wnt signaling pathway	IEA	biological process
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043627	response to estrogen	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0050770	regulation of axonogenesis	IEA	biological process
GO:0050808	synapse organization	IEA	biological process
GO:0051216	cartilage development	IEA	biological process
GO:0060066	oviduct development	IEA	biological process
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0099175	regulation of postsynapse organization	IEA	biological process
GO:2000300	regulation of synaptic vesicle exocytosis	IEA	biological process
GO:2000463	positive regulation of excitatory postsynaptic potential	IEA	biological process
GO:0005109	frizzled binding	IEA	molecular function
GO:0046330	positive regulation of JNK cascade	IEA	biological process
GO:0060070	canonical Wnt signaling pathway	IEA	biological process
GO:0005109	frizzled binding	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0014719	skeletal muscle satellite cell activation	IEA	biological process
GO:0014834	skeletal muscle satellite cell maintenance involved in skeletal muscle regeneration	IEA	biological process
GO:0021707	cerebellar granule cell differentiation	IEA	biological process
GO:0035019	somatic stem cell population maintenance	IEA	biological process
GO:0035115	embryonic forelimb morphogenesis	IEA	biological process
GO:0035116	embryonic hindlimb morphogenesis	IEA	biological process
GO:0045167	asymmetric protein localization involved in cell fate determination	IEA	biological process
GO:0048103	somatic stem cell division	IEA	biological process
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0060065	uterus development	IEA	biological process
GO:0060070	canonical Wnt signaling pathway	IEA	biological process
GO:0060173	limb development	IEA	biological process
GO:0060997	dendritic spine morphogenesis	IEA	biological process
GO:0061038	uterus morphogenesis	IEA	biological process
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	IDA	biological process
GO:0005125	cytokine activity	IDA	molecular function
GO:0048018	receptor ligand activity	IC	molecular function
GO:0048018	receptor ligand activity	IDA	molecular function
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0021846	cell proliferation in forebrain	IDA	biological process
GO:0035313	wound healing, spreading of epidermal cells	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0048864	stem cell development	IDA	biological process
GO:0050768	negative regulation of neurogenesis	IDA	biological process
GO:0060054	positive regulation of epithelial cell proliferation involved in wound healing	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0051965	positive regulation of synapse assembly	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0070307	lens fiber cell development	ISS	biological process
GO:0000578	embryonic axis specification	IMP	biological process
GO:0035115	embryonic forelimb morphogenesis	IMP	biological process
GO:0035116	embryonic hindlimb morphogenesis	IMP	biological process
GO:0042733	embryonic digit morphogenesis	IMP	biological process
GO:0062009	secondary palate development	IMP	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0071560	cellular response to transforming growth factor beta stimulus	IEP	biological process
GO:1905606	regulation of presynapse assembly	IMP	biological process
GO:1905606	regulation of presynapse assembly	EXP	biological process
GO:1905606	regulation of presynapse assembly	IMP	biological process
GO:1905606	regulation of presynapse assembly	IDA	biological process
GO:0098978	glutamatergic synapse	IMP	cellular component
GO:0098978	glutamatergic synapse	EXP	cellular component
GO:0098978	glutamatergic synapse	IMP	cellular component
GO:0098978	glutamatergic synapse	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa05165	Human papillomavirus infection
hsa05205	Proteoglycans in cancer
hsa04310	Wnt signaling pathway
hsa04150	mTOR signaling pathway
hsa04390	Hippo signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa04916	Melanogenesis
hsa05217	Basal cell carcinoma

Diseases

Associated diseases	References
Fuhrmann syndrome	KEGG:H00846
Al-Awadi/Raas-Rothschild syndrome	KEGG:H00847
Fuhrmann syndrome	KEGG:H00846
Al-Awadi/Raas-Rothschild syndrome	KEGG:H00847
leiomyoma	PMID:11232041
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R