• Gene id: 7475

Gene Summary

• Gene Symbol: WNT6   Gene   UCSC   Ensembl
• Gene name: Wnt family member 6
• Alternate names: protein Wnt-6, wingless-type MMTV integration site family, member 6,
• Gene location: 2q35 (218859804: 218874232)     Exons: 4     NC_000002.12
• Gene summary(Entrez): The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog
• OMIM: 614015

Protein Summary

• Protein general information: Q9Y6F9  
  • Name: Protein Wnt 6
  • Length: 365  
  • Mass: 39721
  • Tissue specificity: Expressed in gastric cancer cell lines and gastric cancer tissues (at protein level). Detected in the apical gland region of the gastric foveolar epithelium (at protein level). {ECO
• Sequence:

  MLPPLPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRE
  CQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLPG
  TPGPPGPAGSPEGSAAWEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCH
  GLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRT
  GSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL

• Structural information:
  • Interpro: IPR005817  IPR009143  IPR018161  
  • Prosite: PS00246
  • STRING: ENSP00000233948
• Other Databases: GeneCards:  WNT6  Malacards:  WNT6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045165	cell fate commitment	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005125	cytokine activity	IBA	molecular function
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0030182	neuron differentiation	IBA	biological process
GO:0005109	frizzled binding	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0016055	Wnt signaling pathway	TAS	biological process
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0070062	extracellular exosome	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0009798	axis specification	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0031012	extracellular matrix	IEA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0060684	epithelial-mesenchymal cell signaling	IEA	biological process
GO:0001658	branching involved in ureteric bud morphogenesis	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0072079	nephron tubule formation	IEA	biological process
GO:0072080	nephron tubule development	IEA	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0042475	odontogenesis of dentin-containing tooth	IMP	biological process
GO:0061303	cornea development in camera-type eye	ISS	biological process
GO:0070172	positive regulation of tooth mineralization	IMP	biological process
GO:0071300	cellular response to retinoic acid	ISS	biological process
GO:0030182	neuron differentiation	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa05165	Human papillomavirus infection
hsa05205	Proteoglycans in cancer
hsa04310	Wnt signaling pathway
hsa04150	mTOR signaling pathway
hsa04390	Hippo signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa04916	Melanogenesis
hsa05217	Basal cell carcinoma

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq