About Us

Search Result


Gene id 7473
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol WNT3   Gene   UCSC   Ensembl
Aliases INT4, TETAMS
Gene name Wnt family member 3
Alternate names proto-oncogene Wnt-3, WNT-3 proto-oncogene protein, proto-oncogene Int-4 homolog, wingless-type MMTV integration site family, member 3,
Gene location 17q21.31-q21.32 (46818691: 46762505)     Exons: 5     NC_000017.11
Gene summary(Entrez) The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog
OMIM 604663

Protein Summary

Protein general information P56703  

Name: Proto oncogene Wnt 3 (Proto oncogene Int 4 homolog)

Length: 355  Mass: 39645

Sequence MEPHLLGLLLGLLLGGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCRNYIEIMPSVAEGVKL
GIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTSTICGCDSHHKGPPG
EGWKWGGCSEDADFGVLVSREFADARENRPDARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQP
DFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRAKYSLFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC
NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK
Structural information
Interpro:  IPR005817  IPR009141  IPR018161  
Prosite:   PS00246

PDB:  
6AHY
PDBsum:   6AHY
STRING:   ENSP00000225512
Other Databases GeneCards:  WNT3  Malacards:  WNT3

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0048018 receptor ligand activity
IDA molecular function
GO:1990909 Wnt signalosome
IC cellular component
GO:0010628 positive regulation of ge
ne expression
IDA biological process
GO:1990909 Wnt signalosome
NAS cellular component
GO:0072089 stem cell proliferation
IMP biological process
GO:1905474 canonical Wnt signaling p
athway involved in stem c
ell proliferation
IDA biological process
GO:1904954 canonical Wnt signaling p
athway involved in midbra
in dopaminergic neuron di
fferentiation
IMP biological process
GO:0050767 regulation of neurogenesi
s
IMP biological process
GO:0060070 canonical Wnt signaling p
athway
TAS biological process
GO:0045165 cell fate commitment
IBA biological process
GO:0005615 extracellular space
IBA cellular component
GO:0005125 cytokine activity
IBA molecular function
GO:0060070 canonical Wnt signaling p
athway
IBA biological process
GO:0030182 neuron differentiation
IBA biological process
GO:0005109 frizzled binding
IBA molecular function
GO:0005576 extracellular region
IEA cellular component
GO:0016055 Wnt signaling pathway
IEA biological process
GO:0005102 signaling receptor bindin
g
IEA molecular function
GO:0007275 multicellular organism de
velopment
IEA biological process
GO:0005576 extracellular region
IEA cellular component
GO:0016055 Wnt signaling pathway
IEA biological process
GO:0007275 multicellular organism de
velopment
IEA biological process
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005788 endoplasmic reticulum lum
en
TAS cellular component
GO:0005796 Golgi lumen
TAS cellular component
GO:0005796 Golgi lumen
TAS cellular component
GO:0005796 Golgi lumen
TAS cellular component
GO:0016055 Wnt signaling pathway
TAS biological process
GO:0030666 endocytic vesicle membran
e
TAS cellular component
GO:0030666 endocytic vesicle membran
e
TAS cellular component
GO:0070062 extracellular exosome
TAS cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0048018 receptor ligand activity
IDA molecular function
GO:0060070 canonical Wnt signaling p
athway
IDA biological process
GO:0007276 gamete generation
IEA biological process
GO:0009950 dorsal/ventral axis speci
fication
IEA biological process
GO:0009952 anterior/posterior patter
n specification
IEA biological process
GO:0010628 positive regulation of ge
ne expression
IEA biological process
GO:0030177 positive regulation of Wn
t signaling pathway
IEA biological process
GO:0031012 extracellular matrix
IEA cellular component
GO:0048646 anatomical structure form
ation involved in morphog
enesis
IEA biological process
GO:0048697 positive regulation of co
llateral sprouting in abs
ence of injury
IEA biological process
GO:0060064 Spemann organizer formati
on at the anterior end of
the primitive streak
IEA biological process
GO:0060323 head morphogenesis
IEA biological process
GO:0001707 mesoderm formation
IEA biological process
GO:0007411 axon guidance
IEA biological process
GO:0009948 anterior/posterior axis s
pecification
IEA biological process
GO:0019904 protein domain specific b
inding
IEA molecular function
GO:0035115 embryonic forelimb morpho
genesis
IEA biological process
GO:0035116 embryonic hindlimb morpho
genesis
IEA biological process
GO:0048843 negative regulation of ax
on extension involved in
axon guidance
IEA biological process
GO:0060070 canonical Wnt signaling p
athway
IEA biological process
GO:0060173 limb development
IEA biological process
GO:0005737 cytoplasm
IEA cellular component
GO:0048018 receptor ligand activity
IC molecular function
GO:0005109 frizzled binding
IPI molecular function
GO:0000902 cell morphogenesis
IMP biological process
GO:0005615 extracellular space
TAS cellular component
GO:0060174 limb bud formation
IMP biological process
GO:0060070 canonical Wnt signaling p
athway
IDA biological process
GO:0060070 canonical Wnt signaling p
athway
IDA biological process
GO:0044338 canonical Wnt signaling p
athway involved in mesenc
hymal stem cell different
iation
IMP biological process
GO:0044339 canonical Wnt signaling p
athway involved in osteob
last differentiation
IMP biological process
GO:0005576 extracellular region
IEA cellular component
GO:0060070 canonical Wnt signaling p
athway
IDA biological process
GO:0071300 cellular response to reti
noic acid
ISS biological process
GO:0030182 neuron differentiation
ISS biological process
GO:0005109 frizzled binding
IPI molecular function
GO:0061180 mammary gland epithelium
development
IEP biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05200Pathways in cancer
hsa05010Alzheimer disease
hsa05165Human papillomavirus infection
hsa05206MicroRNAs in cancer
hsa05205Proteoglycans in cancer
hsa04310Wnt signaling pathway
hsa04150mTOR signaling pathway
hsa04390Hippo signaling pathway
hsa05225Hepatocellular carcinoma
hsa04934Cushing syndrome
hsa05226Gastric cancer
hsa04550Signaling pathways regulating pluripotency of stem cells
hsa05224Breast cancer
hsa04916Melanogenesis
hsa05217Basal cell carcinoma
Associated diseases References
Tetra-amelia KEGG:H00636
Tetra-amelia KEGG:H00636
Breast cancer PMID:11604997
Endometrial carcinoma PMID:9099960
Cryptorchidism MIK: 28606200

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract