• Gene id: 7465

Gene Summary

• Gene Symbol: WEE1   Gene   UCSC   Ensembl
• Aliases: WEE1A, WEE1hu
• Gene name: WEE1 G2 checkpoint kinase
• Alternate names: wee1-like protein kinase, WEE1 homolog, WEE1+ homolog, wee1A kinase,
• Gene location: 11p15.4 (9573680: 9589766)     Exons: 12     NC_000011.10
• Gene summary(Entrez): This gene encodes a nuclear protein, which is a tyrosine kinase belonging to the Ser/Thr family of protein kinases. This protein catalyzes the inhibitory tyrosine phosphorylation of CDC2/cyclin B kinase, and appears to coordinate the transition between DN
• OMIM: 193525

Protein Summary

• Protein general information: P30291  
  • Name: Wee1 like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase)
  • Length: 646  
  • Mass: 71,597
• Sequence:

  MSFLSRQQPPPPRRAGAACTLRQKLIFSPCSDCEEEEEEEEEEGSGHSTGEDSAFQEPDSPLPPARSPTEPGPER
  RRSPGPAPGSPGELEEDLLLPGACPGADEAGGGAEGDSWEEEGFGSSSPVKSPAAPYFLGSSFSPVRCGGPGDAS
  PRGCGARRAGEGRRSPRPDHPGTPPHKTFRKLRLFDTPHTPKSLLSKARGIDSSSVKLRGSSLFMDTEKSGKREF
  DVRQTPQVNINPFTPDSLLLHSSGQCRRRKRTYWNDSCGEDMEASDYELEDETRPAKRITITESNMKSRYTTEFH
  ELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDDHMLIQ
  NEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISRTSIPNAASEEGDED
  DWASNKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHE
  IRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSASRKSAEQLRIELNAEKFKNSLLQKELKK
  AQMAKAAAEERALFTDRMATRSTTQSNRTSRLIGKKMNRSVSLTIY

• Structural information:
  • Protein Domains: Protein (299-569)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  IPR017164  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 1X8B 2IN6 2IO6 2Z2W 3BI6 3BIZ 3CQE 3CR0 5V5Y 5VC3 5VC4 5VC5 5VC6 5VD2
  • PDBsum: 1X8B 2IN6 2IO6 2Z2W 3BI6 3BIZ 3CQE 3CR0 5V5Y 5VC3 5VC4 5VC5 5VC6 5VD2
  • DIP: 37969
  • STRING: ENSP00000402084
• Other Databases: GeneCards:  WEE1  Malacards:  WEE1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0000226	microtubule cytoskeleton organization	IEA	biological process
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007067	mitotic nuclear division	IEA	biological process
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0030010	establishment of cell polarity	IEA	biological process
GO:0048812	neuron projection morphogenesis	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0051726	regulation of cell cycle	TAS	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000226	microtubule cytoskeleton organization	IEA	biological process
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0007067	mitotic nuclear division	IEA	biological process
GO:0007067	mitotic nuclear division	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0030010	establishment of cell polarity	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0048812	neuron projection morphogenesis	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0051726	regulation of cell cycle	TAS	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0051726	regulation of cell cycle	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04110	Cell cycle
hsa05170	Human immunodeficiency virus 1 infection

Diseases

Associated diseases	References
Cancer (breast)	GAD: 18950845
Male factor infertility	MIK: 16155078
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male infertility	MIK: 16155078
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
16155078	Male infertility			37 azoospermic patients	Male infertility	CDC2 CCNB1 CCNB2 CDC25A CDC25B CDC25C and WEE1
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R