• Gene id: 7461

Gene Summary

• Gene Symbol: CLIP2   Gene   UCSC   Ensembl
• Aliases: CLIP, CLIP-115, CYLN2, WBSCR3, WBSCR4, WSCR3, WSCR4
• Gene name: CAP-Gly domain containing linker protein 2
• Alternate names: CAP-Gly domain-containing linker protein 2, Williams-Beuren syndrome chromosome region 3, Williams-Beuren syndrome chromosome region 4, cytoplasmic linker 2, cytoplasmic linker protein 115, cytoplasmic linker protein 2, testicular tissue protein Li 40, williams-,
• Gene location: 7q11.23 (74289406: 74405942)     Exons: 17     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene belongs to the family of cytoplasmic linker proteins, which have been proposed to mediate the interaction between specific membranous organelles and microtubules. This protein was found to associate with both microtubules
• OMIM: 165330

Protein Summary

• Protein general information: Q9UDT6  
  • Name: CAP Gly domain containing linker protein 2 (Cytoplasmic linker protein 115) (CLIP 115) (Cytoplasmic linker protein 2) (Williams Beuren syndrome chromosomal region 3 protein) (Williams Beuren syndrome chromosomal region 4 protein)
  • Length: 1046  
  • Mass: 115837
• Sequence:

  MQKPSGLKPPGRGGKHSSPMGRTSTGSASSSAAVAASSKEGSPLHKQSSGPSSSPAAAAAPEKPGPKAAEVGDDF
  LGDFVVGERVWVNGVKPGVVQYLGETQFAPGQWAGVVLDDPVGKNDGAVGGVRYFECPALQGIFTRPSKLTRQPT
  AEGSGSDAHSVESLTAQNLSLHSGTATPPLTSRVIPLRESVLNSSVKTGNESGSNLSDSGSVKRGEKDLRLGDRV
  LVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGFPSTSPAKAKK
  TKRMAMGVSALTHSPSSSSISSVSSVASSVGGRPSRSGLLTETSSRYARKISGTTALQEALKEKQQHIEQLLAER
  DLERAEVAKATSHICEVEKEIALLKAQHEQYVAEAEEKLQRARLLVESVRKEKVDLSNQLEEERRKVEDLQFRVE
  EESITKGDLETQTQLEHARIGELEQSLLLEKAQAERLLRELADNRLTTVAEKSRVLQLEEELTLRRGEIEELQQC
  LLHSGPPPPDHPDAAEILRLRERLLSASKEHQRESGVLRDKYEKALKAYQAEVDKLRAANEKYAQEVAGLKDKVQ
  QATSENMGLMDNWKSKLDSLASDHQKSLEDLKATLNSGPGAQQKEIGELKAVMEGIKMEHQLELGNLQAKHDLET
  AMHVKEKEALREKLQEAQEELAGLQRHWRAQLEVQASQHRLELQEAQDQRRDAELRVHELEKLDVEYRGQAQAIE
  FLKEQISLAEKKMLDYERLQRAEAQGKQEVESLREKLLVAENRLQAVEALCSSQHTHMIESNDISEETIRTKETV
  EGLQDKLNKRDKEVTALTSQTEMLRAQVSALESKCKSGEKKVDALLKEKRRLEAELETVSRKTHDASGQLVLISQ
  ELLRKERSLNELRVLLLEANRHSPGPERDLSREVHKAEWRIKEQKLKDDIRGLREKLTGLDKEKSLSDQRRYSLI
  DRSSAPELLRLQHQLMSTEDALRDALDQAQQVEKLMEAMRSCPDKAQTIGNSGSANGIHQQDKAQKQEDKH

• Structural information:
  • Protein Domains: (99..14-)
    (/note="CAP-Gly-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00045-)
    (239..28-)
    (/note="CAP-Gly-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00045"-)
  • Interpro: IPR036859  IPR000938  IPR028394  
  • Prosite: PS00845 PS50245
  • PDB: 2CP2 2CP3
  • PDBsum: 2CP2 2CP3
  • STRING: ENSP00000223398
• Other Databases: GeneCards:  CLIP2  Malacards:  CLIP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0035371	microtubule plus-end	IBA	cellular component
GO:0051010	microtubule plus-end binding	IBA	molecular function
GO:0005938	cell cortex	IBA	cellular component
GO:0031122	cytoplasmic microtubule organization	IBA	biological process
GO:0008017	microtubule binding	ISS	molecular function
GO:0035371	microtubule plus-end	ISS	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005875	microtubule associated complex	TAS	cellular component
GO:0005881	cytoplasmic microtubule	IEA	cellular component
GO:0051010	microtubule plus-end binding	IEA	molecular function
GO:0035371	microtubule plus-end	IEA	cellular component
GO:0008017	microtubule binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Williams-Beuren syndrome	KEGG:H01439
Williams-Beuren syndrome	KEGG:H01439
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq