• Gene id: 7456

Gene Summary

• Gene Symbol: WIPF1   Gene   UCSC   Ensembl
• Aliases: PRPL-2, WAS2, WASPIP, WIP
• Gene name: WAS/WASL interacting protein family member 1
• Alternate names: WAS/WASL-interacting protein family member 1, WASP-interacting protein, Wiskott-Aldrich syndrome protein interacting protein, protein PRPL-2, testicular tissue protein Li 226,
• Gene location: 2q31.1 (108665068: 108940926)     Exons: 18     NC_000011.10
• Gene summary(Entrez): This gene encodes a protein that plays an important role in the organization of the actin cytoskeleton. The encoded protein binds to a region of Wiskott-Aldrich syndrome protein that is frequently mutated in Wiskott-Aldrich syndrome, an X-linked recessive
• OMIM: 602357

Protein Summary

• Protein general information: O43516  
  • Name: WAS/WASL interacting protein family member 1 (Protein PRPL 2) (Wiskott Aldrich syndrome protein interacting protein) (WASP interacting protein)
  • Length: 503  
  • Mass: 51258
  • Tissue specificity: Highly expressed in peripheral blood mononuclear cells, spleen, placenta, small intestine, colon and thymus. Lower expression in ovary, heart, brain, lung, liver, skeletal muscle, kidney, pancreas, prostate and testis. {ECO
• Sequence:

  MPVPPPPAPPPPPTFALANTEKPTLNKTEQAGRNALLSDISKGKKLKKTVTNDRSAPILDKPKGAGAGGGGGGFG
  GGGGFGGGGGGGGGGSFGGGGPPGLGGLFQAGMPKLRSTANRDNDSGGSRPPLLPPGGRSTSAKPFSPPSGPGRF
  PVPSPGHRSGPPEPQRNRMPPPRPDVGSKPDSIPPPVPSTPRPIQSSPHNRGSPPVPGGPRQPSPGPTPPPFPGN
  RGTALGGGSIRQSPLSSSSPFSNRPPLPPTPSRALDDKPPPPPPPVGNRPSIHREAVPPPPPQNNKPPVPSTPRP
  SASSQAPPPPPPPSRPGPPPLPPSSSGNDETPRLPQRNLSLSSSTPPLPSPGRSGPLPPPPSERPPPPVRDPPGR
  SGPLPPPPPVSRNGSTSRALPATPQLPSRSGVDSPRSGPRPPLPPDRPSAGAPPPPPPSTSIRNGFQDSPCEDEW
  ESRFYFHPISDLPPPEPYVQTTKSYPSKLARNESRSGSNRRERGAPPLPPIPR

• Structural information:
  • Protein Domains: (32..4-)
    (/note="WH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00406"-)
  • Interpro: IPR011993  IPR003124  
  • Prosite: PS51082
  • PDB: 2A41
  • PDBsum: 2A41
  • DIP: 17015
  • STRING: ENSP00000376330
• Other Databases: GeneCards:  WIPF1  Malacards:  WIPF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051015	actin filament binding	IBA	molecular function
GO:0030048	actin filament-based movement	IBA	biological process
GO:0008360	regulation of cell shape	IBA	biological process
GO:0051666	actin cortical patch localization	IBA	biological process
GO:0051127	positive regulation of actin nucleation	IBA	biological process
GO:0006897	endocytosis	IBA	biological process
GO:0005884	actin filament	IBA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0003779	actin binding	TAS	molecular function
GO:0005522	profilin binding	TAS	molecular function
GO:0008154	actin polymerization or depolymerization	TAS	biological process
GO:0015629	actin cytoskeleton	TAS	cellular component
GO:0065003	protein-containing complex assembly	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0030048	actin filament-based movement	IEA	biological process
GO:0005884	actin filament	IEA	cellular component
GO:0051707	response to other organism	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0001726	ruffle	IEA	cellular component
GO:0017124	SH3 domain binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa05130	Pathogenic Escherichia coli infection
hsa05135	Yersinia infection

Diseases

Associated diseases	References
Wiskott-Aldrich syndrome	KEGG:H01523
Wiskott-Aldrich syndrome	KEGG:H01523
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881