• Gene id: 7453

Gene Summary

• Gene Symbol: WARS1   Gene   UCSC   Ensembl
• Aliases: GAMMA-2, HMN9, IFI53, IFP53, WARS
• Gene name: tryptophanyl-tRNA synthetase 1
• Alternate names: tryptophan--tRNA ligase, cytoplasmic, epididymis secretory sperm binding protein, hWRS, interferon-induced protein 53, trpRS, tryptophan tRNA ligase 1, cytoplasmic,
• Gene location: 14q32.2 (100376326: 100333788)     Exons: 15     NC_000014.9
• Gene summary(Entrez): Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first prot
• OMIM: 191050

SNPs

rs680730

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000011.10   g.117604518C>T
NC_000011.9   g.117475233C>T
NG_051656.1   g.197744G>A|SEQ=[C/T]|GENE=DSCAML1

Protein Summary

• Protein general information: P23381  
  • Name: Tryptophan tRNA ligase, cytoplasmic (EC 6.1.1.2) (Interferon induced protein 53) (IFP53) (Tryptophanyl tRNA synthetase) (TrpRS) (hWRS) [Cleaved into: T1 TrpRS; T2 TrpRS]
  • Length: 471  
  • Mass: 53165
• Sequence:

  MPNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGP
  DATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAY
  ENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIAC
  GFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDR
  TDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKH
  AFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRK
  EVTDEIVKEFMTPRKLSFDFQ

• Structural information:
  • Protein Domains: (8..6-)
    (/note="WHEP-TRS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00531"-)
  • Interpro: IPR001412  IPR002305  IPR014729  IPR009068  IPR002306   IPR000738  
  • Prosite: PS00178 PS00762 PS51185
  • CDD: cd00806
  • PDB: 1O5T 1R6T 1R6U 1ULH 2AKE 2AZX 2DR2 2QUH 2QUI 2QUJ 2QUK 5UJI 5UJJ
  • PDBsum: 1O5T 1R6T 1R6U 1ULH 2AKE 2AZX 2DR2 2QUH 2QUI 2QUJ 2QUK 5UJI 5UJJ
  • DIP: 29493
  • STRING: ENSP00000347495
• Other Databases: GeneCards:  WARS1  Malacards:  WARS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004830	tryptophan-tRNA ligase activity	IBA	molecular function
GO:0006436	tryptophanyl-tRNA aminoacylation	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0045765	regulation of angiogenesis	IDA	biological process
GO:0045765	regulation of angiogenesis	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0004830	tryptophan-tRNA ligase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004812	aminoacyl-tRNA ligase activity	IEA	molecular function
GO:0004830	tryptophan-tRNA ligase activity	IEA	molecular function
GO:0006418	tRNA aminoacylation for protein translation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006436	tryptophanyl-tRNA aminoacylation	IEA	biological process
GO:0004812	aminoacyl-tRNA ligase activity	IEA	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0006412	translation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016874	ligase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0006436	tryptophanyl-tRNA aminoacylation	TAS	biological process
GO:0006412	translation	TAS	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0004830	tryptophan-tRNA ligase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0006418	tRNA aminoacylation for protein translation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004830	tryptophan-tRNA ligase activity	IEA	molecular function
GO:0006436	tryptophanyl-tRNA aminoacylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006469	negative regulation of protein kinase activity	IDA	biological process
GO:0032991	protein-containing complex	IMP	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0031334	positive regulation of protein-containing complex assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0001933	negative regulation of protein phosphorylation	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0010835	regulation of protein ADP-ribosylation	IDA	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0019210	kinase inhibitor activity	IDA	molecular function
GO:0005634	nucleus	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0004830	tryptophan-tRNA ligase activity	NAS	molecular function
GO:0006436	tryptophanyl-tRNA aminoacylation	NAS	biological process
GO:0005737	cytoplasm	TAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00970	Aminoacyl-tRNA biosynthesis

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R