• Gene id: 7448

Gene Summary

• Gene Symbol: VTN   Gene   UCSC   Ensembl
• Aliases: V75, VN, VNT
• Gene name: vitronectin
• Alternate names: vitronectin, complement S-protein, epibolin, serum spreading factor, somatomedin B,
• Gene location: 17q11.2 (28370306: 28367283)     Exons: 8     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the pexin family. It is found in serum and tissues and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin se
• OMIM: 612012

Protein Summary

• Protein general information: P04004  
  • Name: Vitronectin (VN) (S protein) (Serum spreading factor) (V75) [Cleaved into: Vitronectin V65 subunit; Vitronectin V10 subunit; Somatomedin B]
  • Length: 478  
  • Mass: 54306
  • Tissue specificity: Expressed in the retina pigment epithelium (at protein level) (PubMed
• Sequence:

  MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEY
  TVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPP
  AEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGS
  QYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSA
  VFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRN
  RKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLR
  TRRVDTVDPPYPRSIAQYWLGCPAPGHL

• Structural information:
  • Protein Domains: (20..6-)
    (/note="SMB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00350"-)
  • Interpro: IPR000585  IPR036375  IPR018487  IPR018486  IPR036024   IPR020436  IPR001212  
  • Prosite: PS00024 PS51642 PS00524 PS50958
  • CDD: cd00094
  • PDB: 1OC0 1S4G 1SSU 2JQ8 3BT1 3BT2 4K24 6O5E
  • PDBsum: 1OC0 1S4G 1SSU 2JQ8 3BT1 3BT2 4K24 6O5E
  • DIP: 36566
  • STRING: ENSP00000226218
• Other Databases: GeneCards:  VTN  Malacards:  VTN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030247	polysaccharide binding	IEA	molecular function
GO:0005044	scavenger receptor activity	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0006955	immune response	TAS	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0030449	regulation of complement activation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005518	collagen binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0008201	heparin binding	IEA	molecular function
GO:0042802	identical protein binding	IEA	molecular function
GO:0051258	protein polymerization	IEA	biological process
GO:0097421	liver regeneration	IEA	biological process
GO:0030198	extracellular matrix organization	IEA	biological process
GO:0048709	oligodendrocyte differentiation	IEA	biological process
GO:0005604	basement membrane	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005796	Golgi lumen	IEA	cellular component
GO:0048237	rough endoplasmic reticulum lumen	IEA	cellular component
GO:0062023	collagen-containing extracellular matrix	IEA	cellular component
GO:0007160	cell-matrix adhesion	IEA	biological process
GO:0010811	positive regulation of cell-substrate adhesion	IEA	biological process
GO:0031012	extracellular matrix	IEA	cellular component
GO:0050840	extracellular matrix binding	IEA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005178	integrin binding	IPI	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	ISS	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0007160	cell-matrix adhesion	IDA	biological process
GO:0062023	collagen-containing extracellular matrix	IDA	cellular component
GO:0032092	positive regulation of protein binding	IDA	biological process
GO:0033627	cell adhesion mediated by integrin	IDA	biological process
GO:0048260	positive regulation of receptor-mediated endocytosis	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0090303	positive regulation of wound healing	IC	biological process
GO:0030949	positive regulation of vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0062023	collagen-containing extracellular matrix	ISS	colocalizes with
GO:0062023	collagen-containing extracellular matrix	HDA	colocalizes with
GO:0010951	negative regulation of endopeptidase activity	IDA	biological process
GO:0014911	positive regulation of smooth muscle cell migration	IDA	biological process
GO:0030195	negative regulation of blood coagulation	IC	biological process
GO:0061302	smooth muscle cell-matrix adhesion	IDA	biological process
GO:0071062	alphav-beta3 integrin-vitronectin complex	TAS	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	HDA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0020003	symbiont-containing vacuole	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0005178	integrin binding	IDA	molecular function
GO:0035987	endodermal cell differentiation	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016477	cell migration	IGI	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0007160	cell-matrix adhesion	IGI	biological process
GO:0005576	extracellular region	NAS	cellular component
GO:0072562	blood microparticle	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa04510	Focal adhesion
hsa05205	Proteoglycans in cancer
hsa04512	ECM-receptor interaction
hsa04610	Complement and coagulation cascades

Diseases

Associated diseases	References
Thrombosis	PMID:15069014
granulomatosis with polyangiitis	PMID:12126637
Churg-Strauss syndrome	PMID:12126637
Coronary artery disease	PMID:15678274
Diabetic retinopathy	PMID:7536680
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq