• Gene id: 7447

Gene Summary

• Gene Symbol: VSNL1   Gene   UCSC   Ensembl
• Aliases: HLP3, HPCAL3, HUVISL1, VILIP, VILIP-1
• Gene name: visinin like 1
• Alternate names: visinin-like protein 1, VLP-1, hippocalcin-like protein 3,
• Gene location: 2p24.2 (17539971: 17657017)     Exons: 6     NC_000002.12
• Gene summary(Entrez): This gene is a member of the visinin/recoverin subfamily of neuronal calcium sensor proteins. The encoded protein is strongly expressed in granule cells of the cerebellum where it associates with membranes in a calcium-dependent manner and modulates intra
• OMIM: 601735

Protein Summary

• Protein general information: P62760  
  • Name: Visinin like protein 1 (VILIP) (VLP 1) (Hippocalcin like protein 3) (HLP3)
  • Length: 191  
  • Mass: 22142
  • Tissue specificity: Brain and retina. Neuron-specific in the central and peripheral nervous system. Increased in the cerebrospinal fluid of Alzheimer disease patients (at protein level). {ECO
• Sequence:

  MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKN
  GDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQR
  VDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK

• Structural information:
  • Protein Domains: (23..5-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (60..9-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (96..13-)
    (/note="EF-hand-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU0044-)
  • Interpro: IPR011992  IPR018247  IPR002048  IPR028846  IPR029533  
  • Prosite: PS00018 PS50222
  • CDD: cd00051
  • STRING: ENSP00000384719
• Other Databases: GeneCards:  VSNL1  Malacards:  VSNL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005509	calcium ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA	biological process
GO:0046676	negative regulation of insulin secretion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0045921	positive regulation of exocytosis	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881