• Gene id: 7441

Gene Summary

• Gene Symbol: VPREB1   Gene   UCSC   Ensembl
• Aliases: CD179a, IGI, IGVPB, VPREB
• Gene name: V-set pre-B cell surrogate light chain 1
• Alternate names: immunoglobulin iota chain, CD179 antigen-like family member A, pre-B lymphocyte 1, v(pre)B protein,
• Gene location: 22q11.22 (42220311: 42228200)     Exons: 3     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the immunoglobulin superfamily and is expressed selectively at the early stages of B cell development, namely, in proB and early preB cells. This gene encodes the iota polypeptide chain that is associated with t
• OMIM: 605141

Protein Summary

• Protein general information: P12018  
  • Name: Immunoglobulin iota chain (CD179 antigen like family member A) (Protein VPreB1) (V(pre)B protein) (VpreB protein) (CD antigen CD179a)
  • Length: 145  
  • Mass: 16605
  • Tissue specificity: Only expressed by pre-B-cells.
• Sequence:

  MSWAPVLLMLFVYCTGCGPQPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQS
  DKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGARSSEKEEREREWEEEMEPTAARTRVP

• Structural information:
  • Protein Domains: (20..13-)
    (/note="Ig-like-V-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013106  
  • Prosite: PS50835
  • PDB: 2H32 2H3N 3BJ9
  • PDBsum: 2H32 2H3N 3BJ9
  • STRING: ENSP00000385361
• Other Databases: GeneCards:  VPREB1  Malacards:  VPREB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0002377	immunoglobulin production	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0050900	leukocyte migration	TAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881