• Gene id: 7434

Gene Summary

• Gene Symbol: VIPR2   Gene   UCSC   Ensembl
• Aliases: C16DUPq36.3, DUP7q36.3, PACAP-R-3, PACAP-R3, VIP-R-2, VPAC2, VPAC2R, VPCAP2R
• Gene name: vasoactive intestinal peptide receptor 2
• Alternate names: vasoactive intestinal polypeptide receptor 2, PACAP type III receptor, VIP and PACAP receptor 2, helodermin-preferring VIP receptor, pituitary adenylate cyclase-activating polypeptide type III receptor,
• Gene location: 7q36.3 (159144956: 159028174)     Exons: 18     NC_000007.14
• Gene summary(Entrez): This gene encodes a receptor for vasoactive intestinal peptide, a small neuropeptide. Vasoactive intestinal peptide is involved in smooth muscle relaxation, exocrine and endocrine secretion, and water and ion flux in lung and intestinal epithelia. Its act
• OMIM: 608329

Protein Summary

• Protein general information: P41587  
  • Name: Vasoactive intestinal polypeptide receptor 2 (VIP R 2) (Helodermin preferring VIP receptor) (Pituitary adenylate cyclase activating polypeptide type III receptor) (PACAP type III receptor) (PACAP R 3) (PACAP R3) (VPAC2)
  • Length: 438  
  • Mass: 49479
  • Tissue specificity: Expressed in CD4+ T-cells, but not in CD8+ T-cells. Expressed in the T-cell lines Jurkat, Peer, MOLT-4, HSB, YT and SUP-T1, but not in the T-cell lines HARRIS and HuT 78. {ECO
• Sequence:

  MRTLLPPALLTCWLLAPVNSIHPECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGETVTVPC
  PKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKITFYILVKAIYTLGYSVSLMSLATGSIILCL
  FRKLHCTRNYIHLNLFLSFILRAISVLVKDDVLYSSSGTLHCPDQPSSWVGCKLSLVFLQYCIMANFFWLLVEGL
  YLHTLLVAMLPPRRCFLAYLLIGWGLPTVCIGAWTAARLYLEDTGCWDTNDHSVPWWVIRIPILISIIVNFVLFI
  SIIRILLQKLTSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYMVFAVFPISISSKYQILFELCLGSFQGLVVAVLY
  CFLNSEVQCELKRKWRSRCPTPSASRDYRVCGSSFSRNGSEGALQFHRGSRAQSFLQTETSVI

• Structural information:
  • Interpro: IPR017981  IPR036445  IPR001879  IPR000832  IPR017983   IPR001571  IPR002284  
  • Prosite: PS00649 PS00650 PS50227 PS50261
  • PDB: 2X57
  • PDBsum: 2X57
  • STRING: ENSP00000262178
• Other Databases: GeneCards:  VIPR2  Malacards:  VIPR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0017046	peptide hormone binding	IBA	molecular function
GO:0004999	vasoactive intestinal polypeptide receptor activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0008528	G protein-coupled peptide receptor activity	IBA	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004999	vasoactive intestinal polypeptide receptor activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0048662	negative regulation of smooth muscle cell proliferation	IEA	biological process
GO:0007190	activation of adenylate cyclase activity	IEA	biological process
GO:0004999	vasoactive intestinal polypeptide receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04024	cAMP signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq