• Gene id: 7431

Gene Summary

• Gene Symbol: VIM   Gene   UCSC   Ensembl
• Gene name: vimentin
• Alternate names: vimentin,
• Gene location: 10p13 (12945813: 12953642)     Exons: 9     NC_000019.10
• Gene summary(Entrez): This gene encodes a type III intermediate filament protein. Intermediate filaments, along with microtubules and actin microfilaments, make up the cytoskeleton. The encoded protein is responsible for maintaining cell shape and integrity of the cytoplasm, a
• OMIM: 193060

Protein Summary

• Protein general information: P08670  
  • Name: Vimentin
  • Length: 466  
  • Mass: 53,652
• Sequence:

  MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRLRSSVP
  GVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLY
  EEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAENTLQSFRQDVDNASLARLDLERKVE
  SLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSE
  AANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEE
  MARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETR
  DGQVINETSQHHDDLE

• Structural information:
  • Protein Domains: IF (103-411)
  • Interpro: IPR001664  IPR006821  IPR018039  IPR027699  
  • Prosite: PS00226 PS51842
  • PDB: 1GK4 1GK6 1GK7 3G1E 3KLT 3S4R 3SSU 3SWK 3TRT 3UF1 4MCY 4MCZ 4MD0 4MD5 4MDI 4MDJ 4YPC 4YV3 6ATF 6ATI
  • PDBsum: 1GK4 1GK6 1GK7 3G1E 3KLT 3S4R 3SSU 3SWK 3TRT 3UF1 4MCY 4MCZ 4MD0 4MD5 4MDI 4MDJ 4YPC 4YV3 6ATF 6ATI
  • DIP: 32507
  • STRING: ENSP00000224237
• Other Databases: GeneCards:  VIM  Malacards:  VIM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001948	glycoprotein binding	IPI	molecular function
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0005200	structural constituent of cytoskeleton	IDA	molecular function
GO:0005212	structural constituent of eye lens	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0005856	cytoskeleton	IDA	cellular component
GO:0005882	intermediate filament	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006928	movement of cell or subcellular component	TAS	biological process
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0010977	negative regulation of neuron projection development	IEA	biological process
GO:0014002	astrocyte development	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0030049	muscle filament sliding	TAS	biological process
GO:0031252	cell leading edge	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0043005	neuron projection	IEA	cellular component
GO:0045109	intermediate filament organization	IEA	biological process
GO:0045111	intermediate filament cytoskeleton	IDA	cellular component
GO:0060020	Bergmann glial cell differentiation	IEA	biological process
GO:0060395	SMAD protein signal transduction	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070307	lens fiber cell development	IEA	biological process
GO:0097110	scaffold protein binding	IPI	molecular function
GO:1990254	keratin filament binding	IPI	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0001948	glycoprotein binding	IPI	molecular function
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0005198	structural molecule activity	IEA	molecular function
GO:0005198	structural molecule activity	IEA	molecular function
GO:0005200	structural constituent of cytoskeleton	IDA	molecular function
GO:0005212	structural constituent of eye lens	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0005856	cytoskeleton	IDA	cellular component
GO:0005882	intermediate filament	IEA	cellular component
GO:0005882	intermediate filament	IEA	cellular component
GO:0005882	intermediate filament	IEA	cellular component
GO:0005882	intermediate filament	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006928	movement of cell or subcellular component	TAS	biological process
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0010977	negative regulation of neuron projection development	IEA	biological process
GO:0014002	astrocyte development	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0030049	muscle filament sliding	TAS	biological process
GO:0031252	cell leading edge	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0045103	intermediate filament-based process	IEA	biological process
GO:0045109	intermediate filament organization	IEA	biological process
GO:0045111	intermediate filament cytoskeleton	IDA	cellular component
GO:0060020	Bergmann glial cell differentiation	IEA	biological process
GO:0060395	SMAD protein signal transduction	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070307	lens fiber cell development	IEA	biological process
GO:0097110	scaffold protein binding	IPI	molecular function
GO:1990254	keratin filament binding	IPI	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0001948	glycoprotein binding	IPI	molecular function
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0005200	structural constituent of cytoskeleton	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0005856	cytoskeleton	IDA	cellular component
GO:0005882	intermediate filament	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006928	movement of cell or subcellular component	TAS	biological process
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0030049	muscle filament sliding	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0045111	intermediate filament cytoskeleton	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0097110	scaffold protein binding	IPI	molecular function
GO:1990254	keratin filament binding	IPI	molecular function
GO:0005886	plasma membrane	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05206	MicroRNAs in cancer
hsa05169	Epstein-Barr virus infection

Diseases

Associated diseases	References
Bulimia	GAD: 20468064
Endometriosis	INFBASE: 20199104
Ovarian endometrial cysts	INFBASE: 24464013
Polycystic ovary syndrome (PCOS)	INFBASE: 24505633
Preterm birth risk	INFBASE: 23382852
Male factor infertility	MIK: 15120973
Spermatogenesis defects	MIK: 3394955
Sertoli cell only syndrome (SCOS)	MIK: 3394955
Spermatogenesis defects	MIK: 3285991
Endometriosis	INFBASE: 24464013
Cataract	KEGG: H01202
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male infertility	MIK: 15120973
Spermatogenic defects	MIK: 3285991
Spermatogenetic arrest	MIK: 3394955
Sertoli cells only-syndrome	MIK: 3394955
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
15120973	Male infertility			8 testis biopsies	Male infertility	Vim Rad23A Rad23B Gsr Gstp 1 Mgst1 Ace Casp1 Ctsd Prlr Tmsb4 and Zfp-37 Hsp 1 Osp94
7534453	Male infertility			228 (10 normal spermatogenesis, 206 with mixed atrophy, 12 with Sertoli Cell Only Syndrome )	Male infertility	cytokeratin  vimentin
3394955	Spermatogenetic arrest, Sertoli cells only-syndrome, Male infertility				Male infertility
3285991	Male infertility, spermatozoa structure				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881