• Gene id: 7430

Gene Summary

• Gene Symbol: EZR   Gene   UCSC   Ensembl
• Aliases: CVIL, CVL, HEL-S-105, VIL2
• Gene name: ezrin
• Alternate names: ezrin, cytovillin 2, epididymis secretory protein Li 105, p81, villin 2 (ezrin),
• Gene location: 6q25.3 (158819423: 158765740)     Exons: 14     NC_000006.12
• Gene summary(Entrez): The cytoplasmic peripheral membrane protein encoded by this gene functions as a protein-tyrosine kinase substrate in microvilli. As a member of the ERM protein family, this protein serves as an intermediate between the plasma membrane and the actin cytosk
• OMIM: 123900

Protein Summary

• Protein general information: P15311  
  • Name: Ezrin (Cytovillin) (Villin 2) (p81)
  • Length: 586  
  • Mass: 69,413
• Sequence:

  MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENP
  LQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSE
  RLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGL
  NIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
  EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEEKTKKAERELSEQIQRALQL
  EEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAK
  EAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNE
  RVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL

• Structural information:
  • Protein Domains: FERM. (2-295)
  • Interpro: IPR019749  IPR011174  IPR011259  IPR000798  IPR014352   IPR035963  IPR019748  IPR019747  IPR000299  IPR018979  IPR018980  IPR008954  IPR011993  IPR029071  
  • Prosite: PS00660 PS00661 PS50057
  • CDD: cd14473
  • PDB: 1NI2 4RM8 4RM9 4RMA
  • PDBsum: 1NI2 4RM8 4RM9 4RMA
  • DIP: 38868
  • STRING: ENSP00000338934
• Other Databases: GeneCards:  EZR  Malacards:  EZR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0001726	ruffle	IDA	cellular component
GO:0001726	ruffle	IDA	cellular component
GO:0001772	immunological synapse	IDA	cellular component
GO:0001931	uropod	IEA	cellular component
GO:0001951	intestinal D-glucose absorption	IEA	biological process
GO:0003376	sphingosine-1-phosphate signaling pathway	IMP	biological process
GO:0003779	actin binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005884	actin filament	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005902	microvillus	IDA	cellular component
GO:0005903	brush border	ISS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0007016	cytoskeletal anchoring at plasma membrane	NAS	biological process
GO:0007159	leukocyte cell-cell adhesion	IEP	biological process
GO:0007411	axon guidance	TAS	biological process
GO:0008017	microtubule binding	IMP	molecular function
GO:0008360	regulation of cell shape	IMP	biological process
GO:0010628	positive regulation of gene expression	IGI	biological process
GO:0010737	protein kinase A signaling	IMP	biological process
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016323	basolateral plasma membrane	ISS	cellular component
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0019898	extrinsic component of membrane	IDA	cellular component
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0022614	membrane to membrane docking	IEP	biological process
GO:0030033	microvillus assembly	IMP	biological process
GO:0030175	filopodium	IDA	cellular component
GO:0030175	filopodium	IDA	cellular component
GO:0030315	T-tubule	IEA	cellular component
GO:0030863	cortical cytoskeleton	TAS	cellular component
GO:0030953	astral microtubule organization	IMP	biological process
GO:0031528	microvillus membrane	IEA	cellular component
GO:0031532	actin cytoskeleton reorganization	IMP	biological process
GO:0031623	receptor internalization	IEA	biological process
GO:0031982	vesicle	IDA	cellular component
GO:0032532	regulation of microvillus length	IEA	biological process
GO:0032587	ruffle membrane	IEA	cellular component
GO:0034236	protein kinase A catalytic subunit binding	IPI	molecular function
GO:0034237	protein kinase A regulatory subunit binding	IPI	molecular function
GO:0034237	protein kinase A regulatory subunit binding	IPI	molecular function
GO:0034629	cellular protein complex localization	IMP	biological process
GO:0036064	ciliary basal body	IEA	cellular component
GO:0040018	positive regulation of multicellular organism growth	IEA	biological process
GO:0042995	cell projection	IDA	cellular component
GO:0043209	myelin sheath	IEA	cellular component
GO:0043622	cortical microtubule organization	IMP	biological process
GO:0044297	cell body	IEA	cellular component
GO:0044393	microspike	IEA	cellular component
GO:0044548	S100 protein binding	IPI	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0044853	plasma membrane raft	IDA	cellular component
GO:0045177	apical part of cell	IDA	cellular component
GO:0046847	filopodium assembly	IMP	biological process
GO:0048015	phosphatidylinositol-mediated signaling	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0050714	positive regulation of protein secretion	IMP	biological process
GO:0050839	cell adhesion molecule binding	IPI	molecular function
GO:0050839	cell adhesion molecule binding	IPI	molecular function
GO:0050860	negative regulation of T cell receptor signaling pathway	IMP	biological process
GO:0051015	actin filament binding	IDA	molecular function
GO:0051017	actin filament bundle assembly	IDA	biological process
GO:0051117	ATPase binding	IPI	molecular function
GO:0051286	cell tip	IEA	cellular component
GO:0051660	establishment of centrosome localization	IMP	biological process
GO:0061028	establishment of endothelial barrier	IGI	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0071320	cellular response to cAMP	IMP	biological process
GO:0071944	cell periphery	IDA	cellular component
GO:0072697	protein localization to cell cortex	IMP	biological process
GO:0090002	establishment of protein localization to plasma membrane	IMP	biological process
GO:0090002	establishment of protein localization to plasma membrane	IMP	biological process
GO:0090004	positive regulation of establishment of protein localization to plasma membrane	IEA	biological process
GO:0097449	astrocyte projection	IEA	cellular component
GO:0097454	Schwann cell microvillus	IEA	cellular component
GO:0098592	cytoplasmic side of apical plasma membrane	IDA	cellular component
GO:1900041	negative regulation of interleukin-2 secretion	IMP	biological process
GO:1902115	regulation of organelle assembly	IGI	biological process
GO:1902115	regulation of organelle assembly	IMP	biological process
GO:1902896	terminal web assembly	IEA	biological process
GO:1902966	positive regulation of protein localization to early endosome	IGI	biological process
GO:1903364	positive regulation of cellular protein catabolic process	IGI	biological process
GO:1903753	negative regulation of p38MAPK cascade	IMP	biological process
GO:2000643	positive regulation of early endosome to late endosome transport	IGI	biological process
GO:2000643	positive regulation of early endosome to late endosome transport	IMP	biological process
GO:0008361	regulation of cell size	IMP	biological process
GO:0022612	gland morphogenesis	IMP	biological process
GO:0032956	regulation of actin cytoskeleton organization	IMP	biological process
GO:0045198	establishment of epithelial cell apical/basal polarity	IMP	biological process
GO:0045198	establishment of epithelial cell apical/basal polarity	IMP	biological process
GO:1901222	regulation of NIK/NF-kappaB signaling	IMP	biological process
GO:0036398	TCR signalosome	IDA	cellular component
GO:0001772	immunological synapse	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0001726	ruffle	IDA	cellular component
GO:0001726	ruffle	IDA	cellular component
GO:0001772	immunological synapse	IDA	cellular component
GO:0001931	uropod	IEA	cellular component
GO:0001951	intestinal D-glucose absorption	IEA	biological process
GO:0003376	sphingosine-1-phosphate signaling pathway	IMP	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0003779	actin binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005622	intracellular	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005884	actin filament	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005902	microvillus	IEA	cellular component
GO:0005902	microvillus	IDA	cellular component
GO:0005903	brush border	IEA	cellular component
GO:0005903	brush border	ISS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005938	cell cortex	IEA	cellular component
GO:0007016	cytoskeletal anchoring at plasma membrane	NAS	biological process
GO:0007159	leukocyte cell-cell adhesion	IEP	biological process
GO:0007411	axon guidance	TAS	biological process
GO:0008017	microtubule binding	IMP	molecular function
GO:0008092	cytoskeletal protein binding	IEA	molecular function
GO:0008360	regulation of cell shape	IEA	biological process
GO:0008360	regulation of cell shape	IMP	biological process
GO:0010628	positive regulation of gene expression	IGI	biological process
GO:0010737	protein kinase A signaling	IMP	biological process
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0016323	basolateral plasma membrane	ISS	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0019898	extrinsic component of membrane	IEA	cellular component
GO:0019898	extrinsic component of membrane	IDA	cellular component
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0022614	membrane to membrane docking	IEP	biological process
GO:0030033	microvillus assembly	IMP	biological process
GO:0030175	filopodium	IEA	cellular component
GO:0030175	filopodium	IDA	cellular component
GO:0030175	filopodium	IDA	cellular component
GO:0030315	T-tubule	IEA	cellular component
GO:0030855	epithelial cell differentiation	IEA	biological process
GO:0030863	cortical cytoskeleton	TAS	cellular component
GO:0030953	astral microtubule organization	IMP	biological process
GO:0031528	microvillus membrane	IEA	cellular component
GO:0031528	microvillus membrane	IEA	cellular component
GO:0031532	actin cytoskeleton reorganization	IMP	biological process
GO:0031623	receptor internalization	IEA	biological process
GO:0031982	vesicle	IDA	cellular component
GO:0032403	protein complex binding	IEA	molecular function
GO:0032532	regulation of microvillus length	IEA	biological process
GO:0032587	ruffle membrane	IEA	cellular component
GO:0034236	protein kinase A catalytic subunit binding	IPI	molecular function
GO:0034237	protein kinase A regulatory subunit binding	IPI	molecular function
GO:0034237	protein kinase A regulatory subunit binding	IPI	molecular function
GO:0034629	cellular protein complex localization	IMP	biological process
GO:0035088	establishment or maintenance of apical/basal cell polarity	IEA	biological process
GO:0036064	ciliary basal body	IEA	cellular component
GO:0040018	positive regulation of multicellular organism growth	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0042995	cell projection	IDA	cellular component
GO:0043209	myelin sheath	IEA	cellular component
GO:0043622	cortical microtubule organization	IMP	biological process
GO:0044297	cell body	IEA	cellular component
GO:0044393	microspike	IEA	cellular component
GO:0044548	S100 protein binding	IPI	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0044853	plasma membrane raft	IDA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0045177	apical part of cell	IEA	cellular component
GO:0045177	apical part of cell	IDA	cellular component
GO:0046847	filopodium assembly	IEA	biological process
GO:0046847	filopodium assembly	IMP	biological process
GO:0048015	phosphatidylinositol-mediated signaling	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0050714	positive regulation of protein secretion	IMP	biological process
GO:0050839	cell adhesion molecule binding	IPI	molecular function
GO:0050839	cell adhesion molecule binding	IPI	molecular function
GO:0050860	negative regulation of T cell receptor signaling pathway	IMP	biological process
GO:0051015	actin filament binding	IDA	molecular function
GO:0051017	actin filament bundle assembly	IDA	biological process
GO:0051117	ATPase binding	IPI	molecular function
GO:0051286	cell tip	IEA	cellular component
GO:0051660	establishment of centrosome localization	IMP	biological process
GO:0061028	establishment of endothelial barrier	IGI	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0071320	cellular response to cAMP	IMP	biological process
GO:0071944	cell periphery	IDA	cellular component
GO:0072697	protein localization to cell cortex	IMP	biological process
GO:0090002	establishment of protein localization to plasma membrane	IMP	biological process
GO:0090002	establishment of protein localization to plasma membrane	IMP	biological process
GO:0090004	positive regulation of establishment of protein localization to plasma membrane	IEA	biological process
GO:0097449	astrocyte projection	IEA	cellular component
GO:0097454	Schwann cell microvillus	IEA	cellular component
GO:0098592	cytoplasmic side of apical plasma membrane	IDA	cellular component
GO:1900041	negative regulation of interleukin-2 secretion	IMP	biological process
GO:1902115	regulation of organelle assembly	IGI	biological process
GO:1902115	regulation of organelle assembly	IMP	biological process
GO:1902896	terminal web assembly	IEA	biological process
GO:1902966	positive regulation of protein localization to early endosome	IGI	biological process
GO:1903364	positive regulation of cellular protein catabolic process	IGI	biological process
GO:1903753	negative regulation of p38MAPK cascade	IMP	biological process
GO:2000643	positive regulation of early endosome to late endosome transport	IGI	biological process
GO:2000643	positive regulation of early endosome to late endosome transport	IMP	biological process
GO:0008361	regulation of cell size	IMP	biological process
GO:0022612	gland morphogenesis	IMP	biological process
GO:0032956	regulation of actin cytoskeleton organization	IMP	biological process
GO:0045198	establishment of epithelial cell apical/basal polarity	IMP	biological process
GO:0045198	establishment of epithelial cell apical/basal polarity	IMP	biological process
GO:1901222	regulation of NIK/NF-kappaB signaling	IMP	biological process
GO:0036398	TCR signalosome	IDA	cellular component
GO:0001772	immunological synapse	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0001726	ruffle	IDA	cellular component
GO:0001726	ruffle	IDA	cellular component
GO:0001772	immunological synapse	IDA	cellular component
GO:0003376	sphingosine-1-phosphate signaling pathway	IMP	biological process
GO:0003779	actin binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005884	actin filament	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005902	microvillus	IDA	cellular component
GO:0005903	brush border	ISS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0007016	cytoskeletal anchoring at plasma membrane	NAS	biological process
GO:0007159	leukocyte cell-cell adhesion	IEP	biological process
GO:0007411	axon guidance	TAS	biological process
GO:0008017	microtubule binding	IMP	molecular function
GO:0008360	regulation of cell shape	IMP	biological process
GO:0010628	positive regulation of gene expression	IGI	biological process
GO:0010737	protein kinase A signaling	IMP	biological process
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016323	basolateral plasma membrane	ISS	cellular component
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0019898	extrinsic component of membrane	IDA	cellular component
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0022614	membrane to membrane docking	IEP	biological process
GO:0030033	microvillus assembly	IMP	biological process
GO:0030175	filopodium	IDA	cellular component
GO:0030175	filopodium	IDA	cellular component
GO:0030863	cortical cytoskeleton	TAS	cellular component
GO:0030953	astral microtubule organization	IMP	biological process
GO:0031532	actin cytoskeleton reorganization	IMP	biological process
GO:0031982	vesicle	IDA	cellular component
GO:0034236	protein kinase A catalytic subunit binding	IPI	molecular function
GO:0034237	protein kinase A regulatory subunit binding	IPI	molecular function
GO:0034237	protein kinase A regulatory subunit binding	IPI	molecular function
GO:0034629	cellular protein complex localization	IMP	biological process
GO:0042995	cell projection	IDA	cellular component
GO:0043622	cortical microtubule organization	IMP	biological process
GO:0044548	S100 protein binding	IPI	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0044853	plasma membrane raft	IDA	cellular component
GO:0045177	apical part of cell	IDA	cellular component
GO:0046847	filopodium assembly	IMP	biological process
GO:0048015	phosphatidylinositol-mediated signaling	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0050714	positive regulation of protein secretion	IMP	biological process
GO:0050839	cell adhesion molecule binding	IPI	molecular function
GO:0050839	cell adhesion molecule binding	IPI	molecular function
GO:0050860	negative regulation of T cell receptor signaling pathway	IMP	biological process
GO:0051015	actin filament binding	IDA	molecular function
GO:0051017	actin filament bundle assembly	IDA	biological process
GO:0051117	ATPase binding	IPI	molecular function
GO:0051660	establishment of centrosome localization	IMP	biological process
GO:0061028	establishment of endothelial barrier	IGI	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0071320	cellular response to cAMP	IMP	biological process
GO:0071944	cell periphery	IDA	cellular component
GO:0072697	protein localization to cell cortex	IMP	biological process
GO:0090002	establishment of protein localization to plasma membrane	IMP	biological process
GO:0090002	establishment of protein localization to plasma membrane	IMP	biological process
GO:0098592	cytoplasmic side of apical plasma membrane	IDA	cellular component
GO:1900041	negative regulation of interleukin-2 secretion	IMP	biological process
GO:1902115	regulation of organelle assembly	IGI	biological process
GO:1902115	regulation of organelle assembly	IMP	biological process
GO:1902966	positive regulation of protein localization to early endosome	IGI	biological process
GO:1903364	positive regulation of cellular protein catabolic process	IGI	biological process
GO:1903753	negative regulation of p38MAPK cascade	IMP	biological process
GO:2000643	positive regulation of early endosome to late endosome transport	IGI	biological process
GO:2000643	positive regulation of early endosome to late endosome transport	IMP	biological process
GO:0008361	regulation of cell size	IMP	biological process
GO:0022612	gland morphogenesis	IMP	biological process
GO:0032956	regulation of actin cytoskeleton organization	IMP	biological process
GO:0045198	establishment of epithelial cell apical/basal polarity	IMP	biological process
GO:0045198	establishment of epithelial cell apical/basal polarity	IMP	biological process
GO:1901222	regulation of NIK/NF-kappaB signaling	IMP	biological process
GO:0036398	TCR signalosome	IDA	cellular component
GO:0001772	immunological synapse	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04530	Tight junction
hsa04810	Regulation of actin cytoskeleton
hsa04670	Leukocyte transendothelial migration
hsa04971	Gastric acid secretion
hsa05206	MicroRNAs in cancer
hsa05205	Proteoglycans in cancer
hsa05130	Pathogenic Escherichia coli infection

Diseases

Associated diseases	References
Cancer (lung)	GAD: 18676680
Cancer (bladder)	GAD: 19692168
Cancer	GAD: 19692168
Cancer (ovarian)	GAD: 20628624
Asthma	GAD: 18682798
Male factor infertility	MIK: 23174138
Asthenozoospermia	MIK: 23174138
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Assocaited with sperm capacitation	MIK: 20711218
Asthenozoospermia	MIK: 23174138
Male infertility	MIK: 23174138
Regulates sertoli cell and sperm adhesion	MIK: 25051438
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
23174138	Idiopathic asthenozoospermia, male infertility			46 (25 infertile patients affected by idiopathic asthenozoospermia, 21 age-matched normospermic fertile donors)	Male infertility	Ezrin  Cdc42 CD9 F-actin and ?-tubulin
20711218	Assocaited with sperm capacitation				Male infertility
25051438	Regulates sertoli cell and sperm adhesion				Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray