• Gene id: 7425

Gene Summary

• Gene Symbol: VGF   Gene   UCSC   Ensembl
• Aliases: SCG7, SgVII
• Gene name: VGF nerve growth factor inducible
• Alternate names: neurosecretory protein VGF, neuro-endocrine specific protein VGF,
• Gene location: 7q22.1 (101169955: 101162508)     Exons: 5     NC_000007.14
• Gene summary(Entrez): This gene is specifically expressed in a subpopulation of neuroendocrine cells, and is upregulated by nerve growth factor. The structural organization of this gene is similar to that of the rat gene, and both the translated and the untranslated regions sh
• OMIM: 602986

Protein Summary

• Protein general information: O15240  
  • Name: Neurosecretory protein VGF [Cleaved into: Neuroendocrine regulatory peptide 1 (NERP 1); Neuroendocrine regulatory peptide 2 (NERP 2); VGF derived peptide TLQP 21; VGF derived peptide TLQP 62; Antimicrobial peptide VGF[554 577]]
  • Length: 615  
  • Mass: 67258
  • Tissue specificity: Central and peripheral nervous systems, synthesized exclusively in neuronal and neuroendocrine cells. {ECO
• Sequence:

  MKALRLSASALFCLLLINGLGAAPPGRPEAQPPPLSSEHKEPVAGDAVPGPKDGSAPEVRGARNSEPQDEGELFQ
  GVDPRALAAVLLQALDRPASPPAPSGSQQGPEEEAAEALLTETVRSQTHSLPAPESPEPAAPPRPQTPENGPEAS
  DPSEELEALASLLQELRDFSPSSAKRQQETAAAETETRTHTLTRVNLESPGPERVWRASWGEFQARVPERAPLPP
  PAPSQFQARMPDSGPLPETHKFGEGVSSPKTHLGEALAPLSKAYQGVAAPFPKARRPESALLGGSEAGERLLQQG
  LAQVEAGRRQAEATRQAAAQEERLADLASDLLLQYLLQGGARQRGLGGRGLQEAAEERESAREEEEAEQERRGGE
  ERVGEEDEEAAEAEAEAEEAERARQNALLFAEEEDGEAGAEDKRSQEETPGHRRKEAEGTEEGGEEEDDEEMDPQ
  TIDSLIELSTKLHLPADDVVSIIEEVEEKRKRKKNAPPEPVPPPRAAPAPTHVRSPQPPPPAPAPARDELPDWNE
  VLPPWDREEDEVYPPGPYHPFPNYIRPRTLQPPSALRRRHYHHALPPSRHYPGREAQARRAQEEAEAEERRLQEQ
  EELENYIEHVLLRRP

• Structural information:
  • Interpro: IPR026128  
  • STRING: ENSP00000249330
• Other Databases: GeneCards:  VGF  Malacards:  VGF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0048167	regulation of synaptic plasticity	IBA	biological process
GO:0005179	hormone activity	IBA	molecular function
GO:0033500	carbohydrate homeostasis	IBA	biological process
GO:0005184	neuropeptide hormone activity	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0008083	growth factor activity	IEA	molecular function
GO:0042742	defense response to bacterium	IEA	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0042593	glucose homeostasis	IEA	biological process
GO:0032868	response to insulin	IEA	biological process
GO:0030073	insulin secretion	IEA	biological process
GO:0019953	sexual reproduction	IEA	biological process
GO:0006091	generation of precursor metabolites and energy	IEA	biological process
GO:0005184	neuropeptide hormone activity	IEA	molecular function
GO:0001541	ovarian follicle development	IEA	biological process
GO:0009409	response to cold	IEA	biological process
GO:0002021	response to dietary excess	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030133	transport vesicle	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0051591	response to cAMP	IEP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881