• Gene id: 7424

Gene Summary

• Gene Symbol: VEGFC   Gene   UCSC   Ensembl
• Aliases: Flt4-L, LMPH1D, LMPHM4, VRP
• Gene name: vascular endothelial growth factor C
• Alternate names: vascular endothelial growth factor C, FLT4 ligand DHM, vascular endothelial growth factor-related protein,
• Gene location: 4q34.3 (176792921: 176683537)     Exons: 7     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family. The encoded protein promotes angiogenesis and endothelial cell growth, and can also affect the permeability of blood
• OMIM: 601528

Protein Summary

• Protein general information: P49767  
  • Name: Vascular endothelial growth factor C (VEGF C) (Flt4 ligand) (Flt4 L) (Vascular endothelial growth factor related protein) (VRP)
  • Length: 419  
  • Mass: 46883
  • Tissue specificity: Spleen, lymph node, thymus, appendix, bone marrow, heart, placenta, ovary, skeletal muscle, prostate, testis, colon and small intestine and fetal liver, lung and kidney, but not in peripheral blood lymphocyte.
• Sequence:

  MHLLGFFSVACSLLAAALLPGPREAPAAAAAFESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELMTVLYP
  EYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNT
  FFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSII
  RRSLPATLPQCQAANKTCPTNYMWNNHICRCLAQEDFMFSSDAGDDSTDGFHDICGPNKELDEETCQCVCRAGLR
  PASCGPHKELDRNSCQCVCKNKLFPSQCGANREFDENTCQCVCKRTCPRNQPLNPGKCACECTESPQKCLLKGKK
  FHHQTCSCYRRPCTNRQKACEPGFSYSEEVCRCVPSYWKRPQMS

• Structural information:
  • Interpro: IPR004153  IPR029034  IPR023581  IPR000072  
  • Prosite: PS00249 PS50278
  • CDD: cd00135
  • PDB: 2X1W 2X1X 4BSK
  • PDBsum: 2X1W 2X1X 4BSK
  • DIP: 5738
  • STRING: ENSP00000480043
• Other Databases: GeneCards:  VEGFC  Malacards:  VEGFC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	IBA	biological process
GO:0001666	response to hypoxia	IBA	biological process
GO:0002040	sprouting angiogenesis	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0038084	vascular endothelial growth factor signaling pathway	IBA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IBA	biological process
GO:0001934	positive regulation of protein phosphorylation	IBA	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IBA	biological process
GO:0005172	vascular endothelial growth factor receptor binding	IBA	molecular function
GO:0008083	growth factor activity	IBA	molecular function
GO:0042056	chemoattractant activity	IBA	molecular function
GO:0043185	vascular endothelial growth factor receptor 3 binding	IBA	molecular function
GO:0045766	positive regulation of angiogenesis	IBA	biological process
GO:0050930	induction of positive chemotaxis	IBA	biological process
GO:0060754	positive regulation of mast cell chemotaxis	IBA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IDA	biological process
GO:0043185	vascular endothelial growth factor receptor 3 binding	IPI	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0001525	angiogenesis	IEA	biological process
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0006929	substrate-dependent cell migration	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050679	positive regulation of epithelial cell proliferation	IEA	biological process
GO:0045776	negative regulation of blood pressure	IEA	biological process
GO:0043536	positive regulation of blood vessel endothelial cell migration	IEA	biological process
GO:0031954	positive regulation of protein autophosphorylation	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0002052	positive regulation of neuroblast proliferation	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:1902462	positive regulation of mesenchymal stem cell proliferation	IEA	biological process
GO:1901492	positive regulation of lymphangiogenesis	IEA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IEA	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0016331	morphogenesis of embryonic epithelium	IEA	biological process
GO:0009887	animal organ morphogenesis	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0050714	positive regulation of protein secretion	IEA	biological process
GO:0043185	vascular endothelial growth factor receptor 3 binding	IEA	molecular function
GO:0042493	response to drug	IEA	biological process
GO:0030947	regulation of vascular endothelial growth factor receptor signaling pathway	IEA	biological process
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0045860	positive regulation of protein kinase activity	IEA	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0045668	negative regulation of osteoblast differentiation	IEA	biological process
GO:0043185	vascular endothelial growth factor receptor 3 binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0050918	positive chemotaxis	IEA	biological process
GO:0050918	positive chemotaxis	IEA	biological process
GO:0050930	induction of positive chemotaxis	IDA	biological process
GO:0042056	chemoattractant activity	IDA	molecular function
GO:0060754	positive regulation of mast cell chemotaxis	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa04015	Rap1 signaling pathway
hsa04510	Focal adhesion
hsa04926	Relaxin signaling pathway
hsa04668	TNF signaling pathway
hsa04933	AGE-RAGE signaling pathway in diabetic complications

Diseases

Associated diseases	References
Hereditary lymphedema	KEGG:H00535
Hereditary lymphedema	KEGG:H00535
Pterygium	PMID:22801834
urinary bladder cancer	PMID:17094484
nephroblastoma	PMID:17257131
Ovarian cancer	PMID:19911196
invasive ductal carcinoma	PMID:19885590
papillary carcinoma	PMID:12203051
Breast carcinoma	PMID:19382240
renal cell carcinoma	PMID:19500329
hepatocellular carcinoma	PMID:18544126
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881