• Gene id: 7423

Gene Summary

• Gene Symbol: VEGFB   Gene   UCSC   Ensembl
• Aliases: VEGFL, VRF
• Gene name: vascular endothelial growth factor B
• Alternate names: vascular endothelial growth factor B, VEGF-related factor,
• Gene location: 11q13.1 (64234583: 64239263)     Exons: 7     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the PDGF (platelet-derived growth factor)/VEGF (vascular endothelial growth factor) family. The VEGF family members regulate the formation of blood vessels and are involved in endothelial cell physiology. This member is a lig
• OMIM: 146631

Protein Summary

• Protein general information: P49765  
  • Name: Vascular endothelial growth factor B (VEGF B) (VEGF related factor) (VRF)
  • Length: 207  
  • Mass: 21602
  • Tissue specificity: Expressed in all tissues except liver. Highest levels found in heart, skeletal muscle and pancreas.
• Sequence:

  MSPLLRRLLLAALLQLAPAQAPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTV
  QRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDRAATPHHRPQPRSV
  PGWDSAPGAPSPADITHPTPAPGPSAHAAPSTTSALTPGPAAAAADAAASSVAKGGA

• Structural information:
  • Interpro: IPR029034  IPR023581  IPR000072  
  • Prosite: PS00249 PS50278
  • CDD: cd00135
  • PDB: 2C7W 2VWE 2XAC
  • PDBsum: 2C7W 2VWE 2XAC
  • DIP: 6045
  • STRING: ENSP00000311127
• Other Databases: GeneCards:  VEGFB  Malacards:  VEGFB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001934	positive regulation of protein phosphorylation	IBA	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IBA	biological process
GO:0005172	vascular endothelial growth factor receptor binding	IBA	molecular function
GO:0008083	growth factor activity	IBA	molecular function
GO:0042056	chemoattractant activity	IBA	molecular function
GO:0043183	vascular endothelial growth factor receptor 1 binding	IBA	molecular function
GO:0045766	positive regulation of angiogenesis	IBA	biological process
GO:0050930	induction of positive chemotaxis	IBA	biological process
GO:0060754	positive regulation of mast cell chemotaxis	IBA	biological process
GO:0001525	angiogenesis	IBA	biological process
GO:0001666	response to hypoxia	IBA	biological process
GO:0002040	sprouting angiogenesis	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0038084	vascular endothelial growth factor signaling pathway	IBA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IBA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0008201	heparin binding	IEA	molecular function
GO:0002576	platelet degranulation	TAS	biological process
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0060976	coronary vasculature development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0001525	angiogenesis	IEA	biological process
GO:0060048	cardiac muscle contraction	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0007507	heart development	IEA	biological process
GO:0006493	protein O-linked glycosylation	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0050918	positive chemotaxis	IEA	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa04015	Rap1 signaling pathway
hsa04510	Focal adhesion
hsa04926	Relaxin signaling pathway
hsa04933	AGE-RAGE signaling pathway in diabetic complications

Diseases

Associated diseases	References
Myocardial infarction	PMID:17975666
Pulmonary hypertension	PMID:12547729
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R