• Gene id: 7416

Gene Summary

• Gene Symbol: VDAC1   Gene   UCSC   Ensembl
• Aliases: PORIN, VDAC-1
• Gene name: voltage dependent anion channel 1
• Alternate names: voltage-dependent anion-selective channel protein 1, outer mitochondrial membrane protein porin 1, plasmalemmal porin, porin 31HL, porin 31HM, sperm binding protein 1a,
• Gene location: 5q31.1 (134070986: 133971874)     Exons: 11     NC_000005.10
• Gene summary(Entrez): This gene encodes a voltage-dependent anion channel protein that is a major component of the outer mitochondrial membrane. The encoded protein facilitates the exchange of metabolites and ions across the outer mitochondrial membrane and may regulate mitoch
• OMIM: 604492

Protein Summary

• Protein general information: P21796  
  • Name: Voltage dependent anion selective channel protein 1 (VDAC 1) (hVDAC1) (Outer mitochondrial membrane protein porin 1) (Plasmalemmal porin) (Porin 31HL) (Porin 31HM)
  • Length: 283  
  • Mass: 30,773
• Sequence:

  MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLETKYRWTEYGLTFTEKW
  NTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRGALVLGYEGWL
  AGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKY
  QIDPDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA

• Structural information:
  • Interpro: IPR023614  IPR001925  IPR027246  IPR030270  
  • Prosite: PS00558
  • PDB: 2JK4 2K4T 5JDP 5XDN 5XDO
  • PDBsum: 2JK4 2K4T 5JDP 5XDN 5XDO
  • DIP: 32862
  • STRING: ENSP00000265333
• Other Databases: GeneCards:  VDAC1  Malacards:  VDAC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001662	behavioral fear response	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006820	anion transport	IDA	biological process
GO:0006851	mitochondrial calcium ion transport	IEA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006915	apoptotic process	IDA	biological process
GO:0007270	neuron-neuron synaptic transmission	IEA	biological process
GO:0007612	learning	IEA	biological process
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0008308	voltage-gated anion channel activity	ISS	molecular function
GO:0008308	voltage-gated anion channel activity	IDA	molecular function
GO:0015288	porin activity	IEA	molecular function
GO:0016020	membrane	ISS	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016236	macroautophagy	TAS	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0030855	epithelial cell differentiation	IEP	biological process
GO:0032403	protein complex binding	IEA	molecular function
GO:0042645	mitochondrial nucleoid	IDA	cellular component
GO:0043209	myelin sheath	IEA	cellular component
GO:0044325	ion channel binding	IPI	molecular function
GO:0045121	membrane raft	IEA	cellular component
GO:0046930	pore complex	TAS	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0098656	anion transmembrane transport	IEA	biological process
GO:1903146	regulation of mitophagy	NAS	biological process
GO:1903959	regulation of anion transmembrane transport	IEA	biological process
GO:2000378	negative regulation of reactive oxygen species metabolic process	IEA	biological process
GO:0001662	behavioral fear response	IEA	biological process
GO:0005253	anion channel activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006810	transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0006820	anion transport	IEA	biological process
GO:0006820	anion transport	IDA	biological process
GO:0006851	mitochondrial calcium ion transport	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006915	apoptotic process	IDA	biological process
GO:0007268	chemical synaptic transmission	IEA	biological process
GO:0007270	neuron-neuron synaptic transmission	IEA	biological process
GO:0007612	learning	IEA	biological process
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0008308	voltage-gated anion channel activity	IEA	molecular function
GO:0008308	voltage-gated anion channel activity	IEA	molecular function
GO:0008308	voltage-gated anion channel activity	ISS	molecular function
GO:0008308	voltage-gated anion channel activity	IDA	molecular function
GO:0015288	porin activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	ISS	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016236	macroautophagy	TAS	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0030855	epithelial cell differentiation	IEP	biological process
GO:0032403	protein complex binding	IEA	molecular function
GO:0042645	mitochondrial nucleoid	IDA	cellular component
GO:0043209	myelin sheath	IEA	cellular component
GO:0043234	protein complex	IEA	cellular component
GO:0044070	regulation of anion transport	IEA	biological process
GO:0044325	ion channel binding	IPI	molecular function
GO:0045121	membrane raft	IEA	cellular component
GO:0046930	pore complex	IEA	cellular component
GO:0046930	pore complex	TAS	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0098656	anion transmembrane transport	IEA	biological process
GO:1903146	regulation of mitophagy	IEA	biological process
GO:1903146	regulation of mitophagy	NAS	biological process
GO:1903959	regulation of anion transmembrane transport	IEA	biological process
GO:2000378	negative regulation of reactive oxygen species metabolic process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006820	anion transport	IDA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006915	apoptotic process	IDA	biological process
GO:0008308	voltage-gated anion channel activity	ISS	molecular function
GO:0008308	voltage-gated anion channel activity	IDA	molecular function
GO:0016020	membrane	ISS	cellular component
GO:0016236	macroautophagy	TAS	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0030855	epithelial cell differentiation	IEP	biological process
GO:0042645	mitochondrial nucleoid	IDA	cellular component
GO:0044325	ion channel binding	IPI	molecular function
GO:0046930	pore complex	TAS	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:1903146	regulation of mitophagy	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04020	Calcium signaling pathway
hsa04022	cGMP-PKG signaling pathway
hsa04217	Necroptosis
hsa04218	Cellular senescence
hsa04621	NOD-like receptor signaling pathway
hsa04979	Cholesterol metabolism
hsa05012	Parkinson disease
hsa05016	Huntington disease
hsa05166	Human T-cell leukemia virus 1 infection
hsa05164	Influenza A

Diseases

Associated diseases	References
Multiple sclerosis	GAD: 21833088
Asthenozoospermia	MIK: 20809416
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
20809416	Idiopathic asthenozoospermia			76 (36 donors, 40 patients using a discontinuous Percoll gradient centrifugation)	Male infertility	VDAC
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray