• Gene id: 7412

Gene Summary

• Gene Symbol: VCAM1   Gene   UCSC   Ensembl
• Aliases: CD106, INCAM-100
• Gene name: vascular cell adhesion molecule 1
• Alternate names: vascular cell adhesion protein 1, CD106 antigen,
• Gene location: 1p21.2 (100719639: 100739044)     Exons: 9     NC_000001.11
• Gene summary(Entrez): This gene is a member of the Ig superfamily and encodes a cell surface sialoglycoprotein expressed by cytokine-activated endothelium. This type I membrane protein mediates leukocyte-endothelial cell adhesion and signal transduction, and may play a role in
• OMIM: 192225

Protein Summary

• Protein general information: P19320  
  • Name: Vascular cell adhesion protein 1 (V CAM 1) (VCAM 1) (INCAM 100) (CD antigen CD106)
  • Length: 739  
  • Mass: 81276
  • Tissue specificity: Expressed on inflamed vascular endothelium, as well as on macrophage-like and dendritic cell types in both normal and inflamed tissue.
• Sequence:

  MPGKMVVILGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGKVTNEG
  TTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEI
  DLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPKN
  TVISVNPSTKLQEGGSVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIAMRMEDSGIYVCEGVNLIGKN
  RKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVRSEGTNSTLTLSPVSF
  ENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGGLVNGSSVTVSCKVPSVYPLDRLEIELLKGETILENI
  EFLEDTDMKSLENKSLEMTFIPTIEDTGKALVCQAKLHIDDMEFEPKQRQSTQTLYVNVAPRDTTVLVSPSSILE
  EGSSVNMTCLSQGFPAPKILWSRQLPNGELQPLSENATLTLISTKMEDSGVYLCEGINQAGRSRKEVELIIQVTP
  KDIKLTAFPSESVKEGDTVIISCTCGNVPETWIILKKKAETGDTVLKSIDGAYTIRKAQLKDAGVYECESKNKVG
  SQLRSLTLDVQGRENNKDYFSPELLVLYFASSLIIPAIGMIIYFARKANMKGSYSLVEAQKSKV

• Structural information:
  • Protein Domains: (25..10-)
    1 (/note="Ig-like-C2-type)
    (109..21-)
    2 (/note="Ig-like-C2-type)
    (223..30-)
    3 (/note="Ig-like-C2-type)
    (312..39-)
    4 (/note="Ig-like-C2-type)
    (408..50-)
    5 (/note="Ig-like-C2-type)
    (511..59-)
    (/note="Ig-lik-)
  • Interpro: IPR003987  IPR007110  IPR036179  IPR013783  IPR008424   IPR013098  IPR003599  IPR003598  IPR013106  IPR013151  IPR003989  
  • Prosite: PS50835
  • PDB: 1IJ9 1VCA 1VSC
  • PDBsum: 1IJ9 1VCA 1VSC
  • STRING: ENSP00000294728
• Other Databases: GeneCards:  VCAM1  Malacards:  VCAM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1904646	cellular response to amyloid-beta	IGI	biological process
GO:0140039	cell-cell adhesion in response to extracellular stimulus	IGI	biological process
GO:0034113	heterotypic cell-cell adhesion	IGI	biological process
GO:0005178	integrin binding	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007155	cell adhesion	IBA	biological process
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005178	integrin binding	IDA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0005178	integrin binding	IDA	molecular function
GO:0005178	integrin binding	IDA	molecular function
GO:0050839	cell adhesion molecule binding	IDA	molecular function
GO:0050839	cell adhesion molecule binding	IPI	molecular function
GO:0050839	cell adhesion molecule binding	IPI	molecular function
GO:0002102	podosome	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005902	microvillus	IDA	cellular component
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IDA	biological process
GO:0007159	leukocyte cell-cell adhesion	IDA	biological process
GO:0007159	leukocyte cell-cell adhesion	IDA	biological process
GO:0007159	leukocyte cell-cell adhesion	IDA	biological process
GO:0030175	filopodium	IDA	cellular component
GO:0030183	B cell differentiation	IC	biological process
GO:0045177	apical part of cell	IDA	cellular component
GO:0022614	membrane to membrane docking	IEP	biological process
GO:0007155	cell adhesion	IDA	biological process
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0042102	positive regulation of T cell proliferation	IDA	biological process
GO:0071065	alpha9-beta1 integrin-vascular cell adhesion molecule-1 complex	IDA	cellular component
GO:0050901	leukocyte tethering or rolling	IEP	biological process
GO:0016020	membrane	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0007160	cell-matrix adhesion	IDA	biological process
GO:0050901	leukocyte tethering or rolling	IDA	biological process
GO:0008131	primary amine oxidase activity	IDA	molecular function
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009308	amine metabolic process	IDA	biological process
GO:0005769	early endosome	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005178	integrin binding	IMP	molecular function
GO:0035584	calcium-mediated signaling using intracellular calcium source	IGI	biological process

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules
hsa05418	Fluid shear stress and atherosclerosis
hsa04670	Leukocyte transendothelial migration
hsa04668	TNF signaling pathway
hsa04064	NF-kappa B signaling pathway
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa05144	Malaria
hsa05143	African trypanosomiasis

Diseases

Associated diseases	References
Lupus nephritis	PMID:22788914
Hypertension	PMID:20569722
Thromboangiitis obliterans	PMID:12086338
pancreatic cancer	PMID:17652277
Essential thrombocythemia	PMID:24434346
Anemia	PMID:18974656
Carotid artery disease	PMID:19717975
Chronic kidney disease	PMID:21111939
Diabetic retinopathy	PMID:19237221
Systemic lupus erythematosus	PMID:18693542
type 2 diabetes mellitus	PMID:18619052
Diabetic neuropathy	PMID:19414982
type 1 diabetes mellitus	PMID:22210567
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)