• Gene id: 7411

Gene Summary

• Gene Symbol: VBP1   Gene   UCSC   Ensembl
• Aliases: HIBBJ46, PFD3, PFDN3, VBP-1
• Gene name: VHL binding protein 1
• Alternate names: prefoldin subunit 3, von Hippel-Lindau binding protein 1,
• Gene location: Xq28 (155197006: 155239840)     Exons: 8     NC_000023.11
• Gene summary(Entrez): The protein encoded by this gene interacts with the Von Hippel-Lindau protein to form an intracellular complex. The encoded protein functions as a chaperone protein, and may play a role in the transport of the Von Hippel-Lindau protein from the perinuclea
• OMIM: 300133

Protein Summary

• Protein general information: P61758  
  • Name: Prefoldin subunit 3 (HIBBJ46) (von Hippel Lindau binding protein 1) (VBP 1) (VHL binding protein 1)
  • Length: 197  
  • Mass: 22626
  • Tissue specificity: Ubiquitous.
• Sequence:

  MAAVKDSCGKGEMATGNGRRLHLGIPEAVFVEDVDSFMKQPGNETADTVLKKLDEQYQKYKFMELNLAQKKRRLK
  GQIPEIKQTLEILKYMQKKKESTNSMETRFLLADNLYCKASVPPTDKVCLWLGANVMLEYDIDEAQALLEKNLST
  ATKNLDSLEEDLDFLRDQFTTTEVNMARVYNWDVKRRNKDDSTKNKA

• Structural information:
  • Interpro: IPR016655  IPR009053  IPR004127  
  • PDB: 6NR8 6NR9 6NRB 6NRC 6NRD
  • PDBsum: 6NR8 6NR9 6NRB 6NRC 6NRD
  • DIP: 46479
  • STRING: ENSP00000286428
• Other Databases: GeneCards:  VBP1  Malacards:  VBP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0005844	polysome	IBA	cellular component
GO:0007021	tubulin complex assembly	IBA	biological process
GO:0016272	prefoldin complex	IBA	cellular component
GO:0007017	microtubule-based process	IBA	biological process
GO:0015631	tubulin binding	IBA	molecular function
GO:0006457	protein folding	IEA	biological process
GO:0016272	prefoldin complex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881