• Gene id: 7408

Gene Summary

• Gene Symbol: VASP   Gene   UCSC   Ensembl
• Gene name: vasodilator stimulated phosphoprotein
• Alternate names: vasodilator-stimulated phosphoprotein,
• Gene location: 19q13.32 (45507458: 45526988)     Exons: 13     NC_000019.10
• Gene summary(Entrez): Vasodilator-stimulated phosphoprotein (VASP) is a member of the Ena-VASP protein family. Ena-VASP family members contain an EHV1 N-terminal domain that binds proteins containing E/DFPPPPXD/E motifs and targets Ena-VASP proteins to focal adhesions. In the
• OMIM: 601703

Protein Summary

• Protein general information: P50552  
  • Name: Vasodilator stimulated phosphoprotein (VASP)
  • Length: 380  
  • Mass: 39830
  • Tissue specificity: Highly expressed in platelets. {ECO
• Sequence:

  MSETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQVVINCAIVRGVKYNQA
  TPNFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALEGGGPPPPPALPTWSVPNGPSPEEVEQQKRQQPGPSE
  HIERRVSNAGGPPAPPAGGPPPPPGPPPPPGPPPPPGLPPSGVPAAAHGAGGGPPPAPPLPAAQGPGGGGAGAPG
  LAAAIAGAKLRKVSKQEEASGGPTAPKAESGRSGGGGLMEEMNAMLARRRKATQVGEKTPKDESANQEEPEARVP
  AQSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQELLEEVKKELQKVKEEIIEAFVQELR
  KRGSP

• Structural information:
  • Protein Domains: (2..11-)
    (/note="WH1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00410"-)
  • Interpro: IPR042180  IPR011993  IPR034367  IPR017354  IPR038023   IPR014885  IPR000697  
  • Prosite: PS50229
  • PDB: 1EGX 1JNG 1USD 1USE 2PAV 2PBD 3CHW
  • PDBsum: 1EGX 1JNG 1USD 1USE 2PAV 2PBD 3CHW
  • DIP: 44105
  • STRING: ENSP00000245932
• Other Databases: GeneCards:  VASP  Malacards:  VASP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001843	neural tube closure	IBA	biological process
GO:0005522	profilin binding	IBA	molecular function
GO:0007411	axon guidance	IBA	biological process
GO:0030838	positive regulation of actin filament polymerization	IBA	biological process
GO:0017124	SH3 domain binding	IBA	molecular function
GO:0030036	actin cytoskeleton organization	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0008154	actin polymerization or depolymerization	IEA	biological process
GO:0017124	SH3 domain binding	IEA	molecular function
GO:0051289	protein homotetramerization	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0017124	SH3 domain binding	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0015629	actin cytoskeleton	TAS	cellular component
GO:0007411	axon guidance	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0034329	cell junction assembly	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030027	lamellipodium	IEA	cellular component
GO:0007411	axon guidance	IEA	biological process
GO:0005925	focal adhesion	IEA	cellular component
GO:0001843	neural tube closure	IEA	biological process
GO:0030175	filopodium	IEA	cellular component
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0045296	cadherin binding	HDA	molecular function
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0031527	filopodium membrane	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0031258	lamellipodium membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0030838	positive regulation of actin filament polymerization	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005925	focal adhesion	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005522	profilin binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04015	Rap1 signaling pathway
hsa04510	Focal adhesion
hsa04022	cGMP-PKG signaling pathway
hsa04530	Tight junction
hsa04611	Platelet activation
hsa04670	Leukocyte transendothelial migration
hsa04666	Fc gamma R-mediated phagocytosis

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray