• Gene id: 7388

Gene Summary

• Gene Symbol: UQCRH   Gene   UCSC   Ensembl
• Aliases: QCR6, UQCR8
• Gene name: ubiquinol-cytochrome c reductase hinge protein
• Alternate names: cytochrome b-c1 complex subunit 6, mitochondrial, complex III subunit 6, cytochrome c1 non-heme 11 kDa protein, mitochondrial hinge protein, ubiquinol-cytochrome c reductase complex 11 kDa protein, ubiquinol-cytochrome c reductase, complex III subunit VIII,
• Gene location: 1p33 (46303697: 46316775)     Exons: 5     NC_000001.11
• OMIM: 614593

Protein Summary

• Protein general information: P07919  
  • Name: Cytochrome b c1 complex subunit 6, mitochondrial (Complex III subunit 6) (Complex III subunit VIII) (Cytochrome c1 non heme 11 kDa protein) (Mitochondrial hinge protein) (Ubiquinol cytochrome c reductase complex 11 kDa protein)
  • Length: 91  
  • Mass: 10739
• Sequence:

  MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFL
  HARDHCVAHKLFNNLK

• Structural information:
  • Interpro: IPR003422  IPR023184  IPR036811  
  • PDB: 5XTE 5XTH 5XTI
  • PDBsum: 5XTE 5XTH 5XTI
  • STRING: ENSP00000309565
• Other Databases: GeneCards:  UQCRH  Malacards:  UQCRH

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005750	mitochondrial respiratory chain complex III	IBA	cellular component
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	IBA	biological process
GO:0009060	aerobic respiration	IBA	biological process
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	IEA	biological process
GO:0008121	ubiquinol-cytochrome-c reductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0070469	respirasome	IEA	cellular component
GO:0008121	ubiquinol-cytochrome-c reductase activity	TAS	molecular function
GO:0006119	oxidative phosphorylation	TAS	biological process
GO:0005746	mitochondrial respirasome	TAS	cellular component
GO:0009060	aerobic respiration	TAS	biological process
GO:0055114	oxidation-reduction process	TAS	biological process
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa05012	Parkinson disease
hsa04714	Thermogenesis
hsa00190	Oxidative phosphorylation
hsa04932	Non-alcoholic fatty liver disease
hsa04260	Cardiac muscle contraction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male infertility	MIK: 18367176

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
18367176	Male infertility				Male infertility	Microarray