• Gene id: 7384

Gene Summary

• Gene Symbol: UQCRC1   Gene   UCSC   Ensembl
• Aliases: D3S3191, QCR1, UQCR1
• Gene name: ubiquinol-cytochrome c reductase core protein 1
• Alternate names: cytochrome b-c1 complex subunit 1, mitochondrial, complex III subunit 1, core protein I, ubiquinol-cytochrome c reductase core protein I, ubiquinol-cytochrome-c reductase complex core protein 1,
• Gene location: 3p21.31 (48609663: 48599001)     Exons: 12     NC_000003.12
• OMIM: 191328

Protein Summary

• Protein general information: P31930  
  • Name: Cytochrome b c1 complex subunit 1, mitochondrial (Complex III subunit 1) (Core protein I) (Ubiquinol cytochrome c reductase complex core protein 1)
  • Length: 480  
  • Mass: 52646
• Sequence:

  MAASVVCRAATAGAQVLLRARRSPALLRTPALRSTATFAQALQFVPETQVSLLDNGLRVASEQSSQPTCTVGVWI
  DVGSRFETEKNNGAGYFLEHLAFKGTKNRPGSALEKEVESMGAHLNAYSTREHTAYYIKALSKDLPKAVELLGDI
  VQNCSLEDSQIEKERDVILREMQENDASMRDVVFNYLHATAFQGTPLAQAVEGPSENVRKLSRADLTEYLSTHYK
  APRMVLAAAGGVEHQQLLDLAQKHLGGIPWTYAEDAVPTLTPCRFTGSEIRHRDDALPFAHVAIAVEGPGWASPD
  NVALQVANAIIGHYDCTYGGGVHLSSPLASGAVANKLCQSFQTFSICYAETGLLGAHFVCDRMKIDDMMFVLQGQ
  WMRLCTSATESEVARGKNILRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIAEVDASVVREICSKYIY
  DQCPAVAGYGPIEQLPDYNRIRSGMFWLRF

• Structural information:
  • Interpro: IPR011249  IPR011765  IPR007863  
  • PDB: 5XTE 5XTH 5XTI
  • PDBsum: 5XTE 5XTH 5XTI
  • STRING: ENSP00000203407
• Other Databases: GeneCards:  UQCRC1  Malacards:  UQCRC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0005743	mitochondrial inner membrane	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0070469	respirasome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0008121	ubiquinol-cytochrome-c reductase activity	TAS	molecular function
GO:0006119	oxidative phosphorylation	TAS	biological process
GO:0005746	mitochondrial respirasome	TAS	cellular component
GO:0009060	aerobic respiration	TAS	biological process
GO:0055114	oxidation-reduction process	TAS	biological process
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	TAS	biological process
GO:0043279	response to alkaloid	IEA	biological process
GO:0014823	response to activity	IEA	biological process
GO:0005750	mitochondrial respiratory chain complex III	IEA	cellular component
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005739	mitochondrion	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa05012	Parkinson disease
hsa04714	Thermogenesis
hsa00190	Oxidative phosphorylation
hsa04932	Non-alcoholic fatty liver disease
hsa04260	Cardiac muscle contraction

Diseases

Associated diseases	References
Alzheimer's disease	PMID:11130185
Alzheimer's disease	PMID:26943237
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)