• Gene id: 7381

Gene Summary

• Gene Symbol: UQCRB   Gene   UCSC   Ensembl
• Aliases: MC3DN3, QCR7, QP-C, QPC, UQBC, UQBP, UQCR6, UQPC
• Gene name: ubiquinol-cytochrome c reductase binding protein
• Alternate names: cytochrome b-c1 complex subunit 7, complex III subunit 7, complex III subunit VII, mitochondrial ubiquinone-binding protein, ubiquinol-cytochrome c reductase complex 14 kDa protein, ubiquinol-cytochrome c reductase, complex III subunit VI,
• Gene location: 8q22.1 (96235544: 96222946)     Exons: 6     NC_000008.11
• Gene summary(Entrez): This gene encodes a subunit of the ubiquinol-cytochrome c oxidoreductase complex, which consists of one mitochondrial-encoded and 10 nuclear-encoded subunits. The protein encoded by this gene binds ubiquinone and participates in the transfer of electrons
• OMIM: 191330

Protein Summary

• Protein general information: P14927  
  • Name: Cytochrome b c1 complex subunit 7 (Complex III subunit 7) (Complex III subunit VII) (QP C) (Ubiquinol cytochrome c reductase complex 14 kDa protein)
  • Length: 111  
  • Mass: 13530
• Sequence:

  MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRMFRIKRALDLNLKHQI
  LPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK

• Structural information:
  • Interpro: IPR003197  IPR036544  
  • PDB: 5XTE 5XTH 5XTI
  • PDBsum: 5XTE 5XTH 5XTI
  • STRING: ENSP00000430494
• Other Databases: GeneCards:  UQCRB  Malacards:  UQCRB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005750	mitochondrial respiratory chain complex III	IBA	cellular component
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	IBA	biological process
GO:0009060	aerobic respiration	IBA	biological process
GO:0034551	mitochondrial respiratory chain complex III assembly	IBA	biological process
GO:0005750	mitochondrial respiratory chain complex III	IEA	cellular component
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0070469	respirasome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006119	oxidative phosphorylation	TAS	biological process
GO:0005746	mitochondrial respirasome	TAS	cellular component
GO:0009060	aerobic respiration	TAS	biological process
GO:0055114	oxidation-reduction process	TAS	biological process
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa05012	Parkinson disease
hsa04714	Thermogenesis
hsa00190	Oxidative phosphorylation
hsa04932	Non-alcoholic fatty liver disease
hsa04260	Cardiac muscle contraction

Diseases

Associated diseases	References
Mitochondrial complex III deficiency	KEGG:H02086
Mitochondrial complex III deficiency	KEGG:H02086
inherited metabolic disorder	PMID:12709789
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray