• Gene id: 738

Gene Summary

• Gene Symbol: VPS51   Gene   UCSC   Ensembl
• Aliases: ANG2, ANG3, C11orf2, C11orf3, FFR, PCH13
• Gene name: VPS51 subunit of GARP complex
• Alternate names: vacuolar protein sorting-associated protein 51 homolog, VPS51, GARP complex subunit, another new gene 2 protein, protein fat-free homolog, vacuolar protein sorting 51 homolog,
• Gene location: 11q13.1 (65096213: 65111861)     Exons: 10     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the vacuolar protein sorting-associated protein 51 family. The encoded protein is a component of the Golgi-associated retrograde protein complex which acts as a tethering factor for carriers in retrograde transport from the e
• OMIM: 615738

Protein Summary

• Protein general information: Q9UID3  
  • Name: Vacuolar protein sorting associated protein 51 homolog (Another new gene 2 protein) (Protein fat free homolog)
  • Length: 782  
  • Mass: 86042
• Sequence:

  MAAAAAAGPSPGSGPGDSPEGPEGEAPERRRKAHGMLKLYYGLSEGEAAGRPAGPDPLDPTDLNGAHFDPEVYLD
  KLRRECPLAQLMDSETDMVRQIRALDSDMQTLVYENYNKFISATDTIRKMKNDFRKMEDEMDRLATNMAVITDFS
  ARISATLQDRHERITKLAGVHALLRKLQFLFELPSRLTKCVELGAYGQAVRYQGRAQAVLQQYQHLPSFRAIQDD
  CQVITARLAQQLRQRFREGGSGAPEQAECVELLLALGEPAEELCEEFLAHARGRLEKELRNLEAELGPSPPAPDV
  LEFTDHGGSGFVGGLCQVAAAYQELFAAQGPAGAEKLAAFARQLGSRYFALVERRLAQEQGGGDNSLLVRALDRF
  HRRLRAPGALLAAAGLADAATEIVERVARERLGHHLQGLRAAFLGCLTDVRQALAAPRVAGKEGPGLAELLANVA
  SSILSHIKASLAAVHLFTAKEVSFSNKPYFRGEFCSQGVREGLIVGFVHSMCQTAQSFCDSPGEKGGATPPALLL
  LLSRLCLDYETATISYILTLTDEQFLVQDQFPVTPVSTLCAEARETARRLLTHYVKVQGLVISQMLRKSVETRDW
  LSTLEPRNVRAVMKRVVEDTTAIDVQVGLLYEEGVRKAQSSDSSKRTFSVYSSSRQQGRYAPSYTPSAPMDTNLL
  SNIQKLFSERIDVFSPVEFNKVSVLTGIIKISLKTLLECVRLRTFGRFGLQQVQVDCHFLQLYLWRFVADEELVH
  LLLDEVVASAALRCPDPVPMEPSVVEVICERG

• Structural information:
  • Interpro: IPR016159  IPR014812  
  • PDB: 4J2C
  • PDBsum: 4J2C
  • DIP: 60562
  • STRING: ENSP00000279281
• Other Databases: GeneCards:  VPS51  Malacards:  VPS51

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032456	endocytic recycling	IBA	biological process
GO:0005802	trans-Golgi network	IBA	cellular component
GO:1990745	EARP complex	IBA	cellular component
GO:0048193	Golgi vesicle transport	IBA	biological process
GO:0042147	retrograde transport, endosome to Golgi	IBA	biological process
GO:0016020	membrane	IBA	cellular component
GO:0007041	lysosomal transport	IBA	biological process
GO:0007030	Golgi organization	IBA	biological process
GO:0000938	GARP complex	IBA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0042147	retrograde transport, endosome to Golgi	IDA	biological process
GO:0000938	GARP complex	IDA	cellular component
GO:0055037	recycling endosome	IDA	cellular component
GO:1990745	EARP complex	IDA	cellular component
GO:0006914	autophagy	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032456	endocytic recycling	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0006869	lipid transport	IEA	biological process
GO:1990745	EARP complex	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0000938	GARP complex	IDA	cellular component
GO:0042147	retrograde transport, endosome to Golgi	IMP	biological process
GO:0007041	lysosomal transport	IMP	biological process
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0005802	trans-Golgi network	IEA	cellular component
GO:0055037	recycling endosome	IEA	cellular component
GO:0055037	recycling endosome	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0016021	integral component of membrane	TAS	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq