• Gene id: 7376

Gene Summary

• Gene Symbol: NR1H2   Gene   UCSC   Ensembl
• Aliases: LXR-b, LXRB, NER, NER-I, RIP15, UNR
• Gene name: nuclear receptor subfamily 1 group H member 2
• Alternate names: oxysterols receptor LXR-beta, LX receptor beta, liver X nuclear receptor beta, nuclear orphan receptor LXR-beta, nuclear receptor NER, steroid hormone-nuclear receptor NER, ubiquitously-expressed nuclear receptor,
• Gene location: 19q13.33 (50376456: 50383387)     Exons: 10     NC_000019.10
• Gene summary(Entrez): The liver X receptors, LXRA (NR1H3; MIM 602423) and LXRB, form a subfamily of the nuclear receptor superfamily and are key regulators of macrophage function, controlling transcriptional programs involved in lipid homeostasis and inflammation. The inducibl

Protein Summary

• Protein general information: P55055  
  • Name: Oxysterols receptor LXR beta (Liver X receptor beta) (Nuclear receptor NER) (Nuclear receptor subfamily 1 group H member 2) (Ubiquitously expressed nuclear receptor)
  • Length: 460  
  • Mass: 50974
  • Tissue specificity: Ubiquitous.
• Sequence:

  MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDWVIPDPEEEPERKRKK
  GPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGARRYACRGGGTCQMDAFMRRKCQQCRLRKCK
  EAGMREQCVLSEEQIRKKKIRKQQQESQSQSQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQEL
  MIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQI
  ALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIAI
  NIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPP
  LLSEIWDVHE

• Structural information:
  • Protein Domains: (222..46-)
    (/note="NR-LBD)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01189"-)
  • Interpro: IPR023257  IPR035500  IPR000536  IPR001723  IPR001628   IPR013088  
  • Prosite: PS51843 PS00031 PS51030
  • PDB: 1P8D 1PQ6 1PQ9 1PQC 1UPV 1UPW 3KFC 3L0E 4DK7 4DK8 4NQA 4RAK 5HJP 5I4V 5JY3 5KYA 5KYJ 6JIO 6S4N 6S4T 6S4U 6S5K
  • PDBsum: 1P8D 1PQ6 1PQ9 1PQC 1UPV 1UPW 3KFC 3L0E 4DK7 4DK8 4NQA 4RAK 5HJP 5I4V 5JY3 5KYA 5KYJ 6JIO 6S4N 6S4T 6S4U 6S5K
  • DIP: 53004
  • STRING: ENSP00000253727
• Other Databases: GeneCards:  NR1H2  Malacards:  NR1H2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0090575	RNA polymerase II transcription regulator complex	IBA	cellular component
GO:0042632	cholesterol homeostasis	IBA	biological process
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0030154	cell differentiation	IBA	biological process
GO:0004879	nuclear receptor activity	IBA	molecular function
GO:0055088	lipid homeostasis	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0008134	transcription factor binding	IBA	molecular function
GO:0006629	lipid metabolic process	IBA	biological process
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0042632	cholesterol homeostasis	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0003707	steroid hormone receptor activity	IEA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0042025	host cell nucleus	IEA	cellular component
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	TAS	molecular function
GO:0004879	nuclear receptor activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0004879	nuclear receptor activity	IEA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0010875	positive regulation of cholesterol efflux	IEA	biological process
GO:0042632	cholesterol homeostasis	IEA	biological process
GO:0090340	positive regulation of secretion of lysosomal enzymes	IEA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0010884	positive regulation of lipid storage	IEA	biological process
GO:0044255	cellular lipid metabolic process	IEA	biological process
GO:0045861	negative regulation of proteolysis	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0046965	retinoid X receptor binding	IEA	molecular function
GO:0055088	lipid homeostasis	IEA	biological process
GO:0090108	positive regulation of high-density lipoprotein particle assembly	IEA	biological process
GO:0090187	positive regulation of pancreatic juice secretion	IEA	biological process
GO:0120163	negative regulation of cold-induced thermogenesis	IEA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA	molecular function
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0046965	retinoid X receptor binding	IEA	molecular function
GO:0048384	retinoic acid receptor signaling pathway	IEA	biological process
GO:0034191	apolipoprotein A-I receptor binding	IPI	molecular function
GO:0051117	ATPase binding	IPI	molecular function
GO:0010745	negative regulation of macrophage derived foam cell differentiation	IC	biological process
GO:0032376	positive regulation of cholesterol transport	IDA	biological process
GO:0010875	positive regulation of cholesterol efflux	IMP	biological process
GO:0032270	positive regulation of cellular protein metabolic process	IMP	biological process
GO:0045723	positive regulation of fatty acid biosynthetic process	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0010867	positive regulation of triglyceride biosynthetic process	IMP	biological process
GO:0010887	negative regulation of cholesterol storage	IMP	biological process
GO:0032369	negative regulation of lipid transport	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0048550	negative regulation of pinocytosis	IMP	biological process
GO:0051006	positive regulation of lipoprotein lipase activity	IMP	biological process
GO:0060336	negative regulation of interferon-gamma-mediated signaling pathway	NAS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0120163	negative regulation of cold-induced thermogenesis	ISS	biological process
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04931	Insulin resistance

Diseases

Associated diseases	References
type 2 diabetes mellitus	PMID:20939869
obesity	PMID:17108812
obesity	PMID:20939869
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray