• Gene id: 7371

Gene Summary

• Gene Symbol: UCK2   Gene   UCSC   Ensembl
• Aliases: TSA903, UK, UMPK
• Gene name: uridine-cytidine kinase 2
• Alternate names: uridine-cytidine kinase 2, cytidine monophosphokinase 2, testis-specific protein TSA903, uridine kinase, uridine monophosphate kinase, uridine monophosphokinase 2,
• Gene location: 1q24.1 (165827613: 165911617)     Exons: 8     NC_000001.11
• Gene summary(Entrez): This gene encodes a pyrimidine ribonucleoside kinase. The encoded protein (EC 2.7.1.48) catalyzes phosphorylation of uridine and cytidine to uridine monophosphate (UMP) and cytidine monophosphate (CMP), respectively.[provided by RefSeq, Oct 2010]
• OMIM: 612602

Protein Summary

• Protein general information: Q9BZX2  
  • Name: Uridine cytidine kinase 2 (UCK 2) (EC 2.7.1.48) (Cytidine monophosphokinase 2) (Testis specific protein TSA903) (Uridine monophosphokinase 2)
  • Length: 261  
  • Mass: 29299
  • Tissue specificity: According to PubMed
• Sequence:

  MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAK
  ALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQ
  MKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHI
  QDILNGGPSKRQTNGCLNGYTPSRKRQASESSSRPH

• Structural information:
  • Interpro: IPR027417  IPR006083  IPR029925  IPR000764  
  • CDD: cd02023
  • PDB: 1UDW 1UEI 1UEJ 1UFQ 1UJ2 1XRJ 6N53 6N54 6N55
  • PDBsum: 1UDW 1UEI 1UEJ 1UFQ 1UJ2 1XRJ 6N53 6N54 6N55
  • STRING: ENSP00000356853
• Other Databases: GeneCards:  UCK2  Malacards:  UCK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016301	kinase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0019206	nucleoside kinase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004849	uridine kinase activity	IEA	molecular function
GO:0043097	pyrimidine nucleoside salvage	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0044211	CTP salvage	IEA	biological process
GO:0044206	UMP salvage	IEA	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0016301	kinase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0019206	nucleoside kinase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004849	uridine kinase activity	IEA	molecular function
GO:0043097	pyrimidine nucleoside salvage	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0044211	CTP salvage	IEA	biological process
GO:0044206	UMP salvage	IEA	biological process
GO:0005575	cellular_component	ND	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00983	Drug metabolism - other enzymes
hsa00240	Pyrimidine metabolism

Diseases

Associated diseases	References
pancreatic cancer	PMID:12149149
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray