• Gene id: 7360

Gene Summary

• Gene Symbol: UGP2   Gene   UCSC   Ensembl
• Aliases: EIEE83, SVUGP2, UDPG, UDPGP, UDPGP2, UGP1, UGPP1, UGPP2, pHC379
• Gene name: UDP-glucose pyrophosphorylase 2
• Alternate names: UTP--glucose-1-phosphate uridylyltransferase, UDP-glucose diphosphorylase, UDP-glucose pyrophosphorylase 1, UGPase 2, UTP--glucose-1-phosphate uridylyltransferase 2, UTP-glucose-1-phosphate uridyltransferase, Uridyl diphosphate glucose pyrophosphorylase-1, testi,
• Gene location: 2p15 (63840968: 63891561)     Exons: 16     NC_000002.12
• Gene summary(Entrez): The enzyme encoded by this gene is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct p
• OMIM: 191760

Protein Summary

• Protein general information: Q16851  
  • Name: UTP glucose 1 phosphate uridylyltransferase (EC 2.7.7.9) (UDP glucose pyrophosphorylase) (UDPGP) (UGPase)
  • Length: 508  
  • Mass: 56940
• Sequence:

  MSRFVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDW
  GKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLN
  KTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGD
  IYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEG
  KLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAA
  IKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIP
  DMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH

• Structural information:
  • Interpro: IPR029044  IPR002618  IPR016267  
  • CDD: cd00897
  • PDB: 3R2W 3R3I 4R7P
  • PDBsum: 3R2W 3R3I 4R7P
  • STRING: ENSP00000338703
• Other Databases: GeneCards:  UGP2  Malacards:  UGP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003983	UTP:glucose-1-phosphate uridylyltransferase activity	IBA	molecular function
GO:0005977	glycogen metabolic process	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0006011	UDP-glucose metabolic process	IBA	biological process
GO:0003983	UTP:glucose-1-phosphate uridylyltransferase activity	IEA	molecular function
GO:0070569	uridylyltransferase activity	IEA	molecular function
GO:0006011	UDP-glucose metabolic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0003983	UTP:glucose-1-phosphate uridylyltransferase activity	TAS	molecular function
GO:0006011	UDP-glucose metabolic process	TAS	biological process
GO:0003983	UTP:glucose-1-phosphate uridylyltransferase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005978	glycogen biosynthetic process	TAS	biological process
GO:0006065	UDP-glucuronate biosynthetic process	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032557	pyrimidine ribonucleotide binding	IEA	molecular function
GO:0005536	glucose binding	IEA	molecular function
GO:0003983	UTP:glucose-1-phosphate uridylyltransferase activity	IEA	molecular function
GO:0019255	glucose 1-phosphate metabolic process	IEA	biological process
GO:0006011	UDP-glucose metabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003983	UTP:glucose-1-phosphate uridylyltransferase activity	TAS	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005634	nucleus	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00520	Amino sugar and nucleotide sugar metabolism
hsa00040	Pentose and glucuronate interconversions
hsa00500	Starch and sucrose metabolism
hsa00052	Galactose metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881